KEGG   Candidatus Accumulibacter cognatus: HWD57_11530
Entry
HWD57_11530       CDS       T10916                                 
Symbol
msbA
Name
(GenBank) lipid A export permease/ATP-binding protein MsbA
  KO
K11085  ATP-binding cassette, subfamily B, bacterial MsbA [EC:7.5.2.6]
Organism
acog  Candidatus Accumulibacter cognatus
Pathway
acog02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:acog00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    HWD57_11530 (msbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acog02000]
    HWD57_11530 (msbA)
Enzymes [BR:acog01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.6  ABC-type lipid A-core oligosaccharide transporter
     HWD57_11530 (msbA)
Transporters [BR:acog02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    HWD57_11530 (msbA)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 AAA_22 ABC_ATPase AAA_29 nSTAND3 RsgA_GTPase AAA_30 NACHT MMR_HSR1 nSTAND1 NB-ARC HUTI_composite_bact DUF87
Other DBs
NCBI-ProteinID: QLH50345
UniProt: A0A080MKL6
LinkDB
Position
complement(2560361..2562187)
AA seq 608 aa
MPSANTPSVSSLRIYFRLLGYLRPLLGLFLISLLGYLMFASSSPMMAAILKYFVDGLNAP
SGETQLAVPLLGEIDLIYSMPLLLVIVVTWQGIGSFLGSYYLARVSLGLIDDLRRVLFDS
LLRLPNAYFDQHNSGHLISRITYDVTMVTGAATEAIKVVIREGMTVIFLFGYLLWMNWKL
TLVLVAILPVIALMVSRASRKFRKQSRKIQAAMGDLTHIASETIQGYRVVRSFGGEDYES
ARFRAASADNTAKQLRMVKTVAGYTPVLQFVTFSTMAALLILVLLLRGDSSAGDLVAYIT
AAGMLPKPIRQLSEVSATIQKGLAGAESIFAQLDEVPEPDHGHVERDHVSGHLQIKDLSF
VYAGTTQCVLDGVSLSVTPGQMVALVGRSGSGKSTLANLIPRFYRHNSGQILIDGVDVED
YTLLNLRRHIALVTQQVVLFNDTIANNIAYGALSTAPREAIAKAAEAAFASEFIDRLPDG
YDTLVGENGVMLSGGQRQRLAIARALLKDAPILILDEATSALDTESERHIQDALDRVMAG
RTTLVIAHRLSTVEKADQILVMEQGRIVERGTHSELLAANGHYARLHAMQFQDDAVLANE
KAPDSKAE
NT seq 1827 nt   +upstreamnt  +downstreamnt
atgccctccgcgaataccccgtctgtttcctcattgcgtatctatttccggctcctgggc
tatctgcgccctttgctcggcctgttcctgatcagcctgctgggttacctgatgttcgca
tcatcgtcaccgatgatggctgcaattctgaaatatttcgtcgatggactgaatgcgccc
agcggcgaaacacaactggccgtcccgctgcttggcgagatcgacctgatctacagcatg
cccctgctactggtgatagtcgtcacctggcaaggaattggctcttttctcggctcctac
tacctggcaagggtttcgctgggactgatcgatgatctgcggcgcgtccttttcgacagc
ctgctgcgcctgccgaacgcctatttcgaccagcataactcggggcatctgatctctcgc
atcacctacgatgtgaccatggtcaccggcgcggcgaccgaagccatcaaggtggtgata
cgcgaaggaatgactgtcatcttcctgttcggttatctgctgtggatgaactggaaactg
accctggtactggtcgccatcctgccggtcatagccctgatggtcagccgcgccagccgc
aagtttcgcaagcagagcaggaaaatacaggccgcaatgggcgatctgacgcatatcgcg
tcggaaaccatccagggctaccgggtggtgcgcagtttcggcggcgaggattatgaatcg
gcgcgcttccgggcggccagcgcagacaacaccgccaagcagttgcgcatggtcaagact
gttgccggctacacgccggtgctgcaatttgtcaccttcagcacgatggctgcgctgctg
atactggtcctgttgctgcgcggcgattcctcagccggcgacttggtcgcttacatcacc
gcggccggcatgttgccgaagccgattcgccagttatccgaagtcagtgccacgattcag
aaaggtctggcgggtgccgagagcatcttcgcccaactcgacgaagtccctgaaccggat
catggccacgtcgaaagggatcatgtcagcggtcatctgcagatcaaggacctctctttc
gtctatgccgggactacgcaatgcgtgctcgacggggtcagcctctcggtcacgcccggg
cagatggtggcgctggtcgggcgctcgggaagtggcaagtcgaccctggccaacctgatt
ccccgcttctatcgccacaactccggccaaatcctgatcgacggcgtcgacgtcgaggac
tacaccttgctcaacctgcgtcggcatattgcgctggtgacacagcaggtggtgttgttc
aacgacaccatcgccaacaacatcgcctatggcgccctttcgacagcgccgcgggaggcg
atcgcaaaggccgccgaggcagcctttgcgagcgagttcattgaccgcctgccggatggc
tacgacacgctagttggtgaaaatggcgtgatgctgtcaggcgggcagcgccagcgcttg
gcgattgcccgggcactgctaaaggatgcaccgatcctgattctcgacgaagcaacttcg
gcactcgataccgaatcggaacgtcacatccaggatgccctcgatcgggtgatggccggg
cgaacgacactggttatcgcacaccgcctgtcgaccgtcgaaaaggctgaccaaatcctg
gtcatggaacaagggcgcatcgtcgaacgtggcacccactcggagttgctggccgcgaat
ggccactacgcacgcctgcacgccatgcagtttcaggacgatgcggtattagccaacgaa
aaggctccagacagcaaagcggaataa

DBGET integrated database retrieval system