Candidatus Accumulibacter cognatus: HWD57_22305 Help Entry HWD57_22305       CDS       T10916                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism acog  Candidatus Accumulibacter cognatus Brite KEGG Orthology (KO) [BR:acog00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:acog03032]     HWD57_22305    03036 Chromosome and associated proteins [BR:acog03036]     HWD57_22305    03400 DNA repair and recombination proteins [BR:acog03400]     HWD57_22305 DNA replication proteins [BR:acog03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     HWD57_22305 Chromosome and associated proteins [BR:acog03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     HWD57_22305 DNA repair and recombination proteins [BR:acog03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       HWD57_22305 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF979 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  QLH52205 UniProt:  A0A7D5SQC2 LinkDB All DBs Position complement(4943897..4944181) Genome browser AA seq 94 aa AA seqDB search MNKSEMIDAIAARTDLSKVASAKALDAVIETIVESVAQGEAVTLVGFGSFKASERAAREG KNPKTGAKILIPQTIVPKFAAGATFKARVAGKDE NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaacaagtccgaaatgatcgatgccatcgccgcgcgtaccgacctgtcgaaggtcgcg tccgcgaaagcactggatgctgtaatcgagactatcgttgaatcggttgcccaaggggag gcggtaaccctggtcggtttcggctccttcaaggcaagtgagcgcgctgcccgggaaggc aagaatccgaagactggtgcaaaaatcctgatcccgcaaaccatcgttccgaagtttgcc gctggcgcaactttcaaggccagggttgcaggcaaggatgagtaa

DBGET integrated database retrieval system