Anaerotruncus colihominis: K5I23_00495 Help Entry K5I23_00495       CDS       T08068                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism acol  Anaerotruncus colihominis Pathway acol00020   Citrate cycle (TCA cycle) acol00720   Other carbon fixation pathways acol01100   Metabolic pathways acol01110   Biosynthesis of secondary metabolites acol01120   Microbial metabolism in diverse environments acol01200   Carbon metabolism acol01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:acol00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     K5I23_00495   09102 Energy metabolism    00720 Other carbon fixation pathways     K5I23_00495 Enzymes [BR:acol01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      K5I23_00495 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_21 Fer4_2 Fer4_9 Fer4_10 Fer4_15 Fer4_6 LdpA_Fe-S-bd Fer4_3 Fer4_16 Fer4_8 Fer4_13 Fer4_22 Fer4_4 Fer4_17 Fer4_18 Motif Other DBs NCBI-ProteinID:  UOX65755 LinkDB All DBs Position complement(91780..91986) Genome browser AA seq 68 aa AA seqDB search MAKMTVNRDTCKGCGLCVQVCPKKIISLDKKALNQKGYHPACVEDMSKCIGCAMCAQMCP DCAITVEK NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggcgaaaatgacggtcaatcgggacacgtgcaagggctgcgggctttgcgtgcaggtc tgccctaagaaaattatttctcttgacaaaaaggcgctgaaccagaaggggtatcatcct gcctgcgtcgaggacatgagcaagtgcatcgggtgtgcgatgtgcgctcagatgtgtccg gactgcgcgattacggttgagaaatag

DBGET integrated database retrieval system