Anaerotruncus colihominis: K5I23_07700
Help
Entry
K5I23_07700 CDS
T08068
Symbol
ilvB
Name
(GenBank) biosynthetic-type acetolactate synthase large subunit
KO
K01652
acetolactate synthase I/II/III large subunit [EC:
2.2.1.6
]
Organism
acol
Anaerotruncus colihominis
Pathway
acol00290
Valine, leucine and isoleucine biosynthesis
acol00650
Butanoate metabolism
acol00660
C5-Branched dibasic acid metabolism
acol00770
Pantothenate and CoA biosynthesis
acol01100
Metabolic pathways
acol01110
Biosynthesis of secondary metabolites
acol01210
2-Oxocarboxylic acid metabolism
acol01230
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:
acol00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00650 Butanoate metabolism
K5I23_07700 (ilvB)
00660 C5-Branched dibasic acid metabolism
K5I23_07700 (ilvB)
09105 Amino acid metabolism
00290 Valine, leucine and isoleucine biosynthesis
K5I23_07700 (ilvB)
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
K5I23_07700 (ilvB)
Enzymes [BR:
acol01000
]
2. Transferases
2.2 Transferring aldehyde or ketonic groups
2.2.1 Transketolases and transaldolases
2.2.1.6 acetolactate synthase
K5I23_07700 (ilvB)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
TPP_enzyme_N
TPP_enzyme_C
TPP_enzyme_M
XFP_N
DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID:
UOX67078
LinkDB
All DBs
Position
1565209..1566819
Genome browser
AA seq
536 aa
AA seq
DB search
MIISGAQAMVNCLEAQGVSVVFGYPGAAICPFYDCLAQSGIRHILVRSEQNAGHAASGYA
RVAGRPGVCIATSGPGATNLLTALATAYADSIPLVAITGQVETGLLGRDVFQEVDTTGAA
SPFIKYSYLVEDARDIPRVFREAFYIASTGRPGPVLIDMPVDIQRAQLDFAYPETVSIRG
YKPRIQGHAGQVERVARALCAARRPLLVVGGGAVGARGSVRRLCEMCGLPAVSTMMGIGT
LPSKHPLYFGMLGQSGAPAANEAVGQSDLLMILGARADNRAMGRPGCLGADKTVIHIDID
TAEIGKNVGTTIPLVGDAAAVLAQLCERRLHGDWQEWTAWLDSLRDCPRAPAEAAGFIDP
EAFVRLLSQELDGDAVYVSDVGQNQIWSARNYDARGGLFLTTGGMGTMGYALPAAIGARL
AAPGRQVVAVCGDGAFQMEMMELATANQHGVTVKLVVMNNQMLGMVREIQHDGYGGRETA
VALGGGPGLSKIAEAYQIRYLRLDAMENARETVRAFLKTDDSCILECAVDPRAATH
NT seq
1611 nt
NT seq
+upstream
nt +downstream
nt
atgatcatcagcggtgcgcaggcaatggtaaactgtcttgaggcacagggcgtaagcgtc
gtgtttggatatcccggggcggcaatctgcccgttttatgactgcctggcgcagtccggg
atccgccatatcctggtgcgaagcgagcagaatgcaggacatgcggccagcggctacgcg
cgtgttgcaggcaggccaggcgtctgtatcgcgacaagcggccccggcgcgaccaacctg
cttaccgcgctggctacagcgtatgccgacagcattccgcttgtggcgatcaccgggcag
gtggaaacgggactgcttggccgcgacgtattccaggaggtcgatacgaccggcgcagcg
tcgccgtttatcaaatacagctatctggtcgaggatgcgagggatattccgcgcgtattc
agggaagccttttatatcgcttcgaccgggcggccgggtcctgtgctgatcgatatgcct
gtcgatatccagcgcgcgcagctcgactttgcctacccggagacggtttcaatccgcgga
tataagccccgtatccaggggcatgccggccaggtggaacgcgtggccagggcgctttgc
gctgccagacggccgctgctcgtcgtgggcggcggcgcggtcggagcgcgcggcagcgtg
cgcaggctgtgcgagatgtgcgggctgcccgccgtttccacgatgatgggcatcggcacg
ctgccgtcgaagcatccgctttatttcggcatgctcggacagagcggcgcgccggccgcc
aacgaggcagtcggtcagagcgatctgctgatgatcctcggcgcgcgcgcggacaaccgg
gcgatgggccggccaggctgtttgggcgcggataagacggtgattcacatcgatatcgat
acggcggagatcggtaagaatgtcggcacgacaatcccgcttgtcggcgatgcggcggcg
gtgctcgcgcagctgtgcgagcggcggctgcatggcgactggcaggaatggaccgcatgg
cttgacagcctgcgggactgcccgcgggcgcctgccgaggccgccggctttattgacccg
gaggcgtttgtacggctgctctcgcaggagctggacggcgatgcggtttatgtttcggat
gtcgggcagaaccagatctggtcggcgagaaactacgatgcgcgcggcggcctgtttttg
acgacgggcggcatgggaacgatgggatacgcgctgccggccgcgataggggcgcgcctg
gccgcgccggggcggcaggttgtggctgtctgcggcgacggggcgtttcagatggaaatg
atggaactggcgaccgccaatcagcacggcgtaacggtcaagctggtcgtgatgaataat
cagatgctcggcatggtgcgcgaaattcagcatgacggctatggcgggcgcgaaacagcc
gtcgcgctcggcggcgggccagggctgtcaaagatcgccgaggcataccagattcgatat
ctccgccttgacgcgatggagaacgcgcgcgaaaccgtgcgcgcctttttaaaaacggat
gattcctgtatcctggagtgcgccgtggacccgcgcgcggccacacattga
DBGET
integrated database retrieval system