KEGG   Anaerotruncus colihominis: K5I23_13550
Entry
K5I23_13550       CDS       T08068                                 
Symbol
fliY
Name
(GenBank) flagellar motor switch phosphatase FliY
  KO
K02417  flagellar motor switch protein FliN
Organism
acol  Anaerotruncus colihominis
Pathway
acol02030  Bacterial chemotaxis
acol02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:acol00001]
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    K5I23_13550 (fliY)
   02040 Flagellar assembly
    K5I23_13550 (fliY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acol02044]
    K5I23_13550 (fliY)
   02035 Bacterial motility proteins [BR:acol02035]
    K5I23_13550 (fliY)
Secretion system [BR:acol02044]
 Type III secretion system
  Flagellar export apparatus
   K5I23_13550 (fliY)
Bacterial motility proteins [BR:acol02035]
 Flagellar system
  Flagellar assembly proteins
   C ring
    K5I23_13550 (fliY)
SSDB
Motif
Pfam: CheC FliMN_C CheX CdsD_C
Other DBs
NCBI-ProteinID: UOX65003
LinkDB
Position
2733663..2735003
AA seq 446 aa
MSEELLQKEVSVPSISMMEQDAIGEVLNISMGSSATAVSSLLDRQVNISTPSVSVREFHT
LDYSAMEPALIVKIEYVEGISGNNVMVFRQRDIQIILNLLMGNDDPPSDDFEFDELSMSA
ACEVMNQMMGAAATALSEFLNRVVNISTPTASVVTSEDSYRDAIGVQEGDEIVAVSFHID
IQDVMNSDFVSILTCSLAKEIVEQIMGNNQESLENIHAPAQPPAAAAAQEQSAASPQSAM
QPPAAAAAPQPPVTQAAPPQPAMQQPAVAMDMAAQQPAMQQPGMMPPEMQHPGMQPAYGM
PPYGQMPYGYPMYPMPPYPQQAYGMQEPQPATQKPINVQNTQFPQFTVQQTDSPTSNANM
DLLMGVSLDVSVEIGQTKRKIKDIIDFGQGTVIELNKQAGAPVDIVVNGRLLARGDVVVI
DDNFGVRITEIVGTKELMESLKEDAV
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgagtgaagaattgcttcagaaggaagtgtctgtgccgtccattagcatgatggaacag
gacgcgatcggcgaagtgctgaatatcagcatgggttcgtccgcgactgcggttagcagc
ctgttggatcgacaggttaatatttccacaccatctgtcagtgtgcgtgaatttcatacg
cttgattacagtgcgatggaaccggcgctgatcgttaaaattgaatatgtggaaggtatc
tcaggaaacaatgtgatggttttccgtcagcgtgatatccagattattttgaacctgtta
atgggcaacgacgatccgccgtctgatgactttgagtttgatgagttaagcatgagcgcg
gcctgcgaggttatgaaccagatgatgggcgcggcggcaactgctctttcagaattttta
aaccgtgtcgtcaatatttcaacgccgaccgcgtctgttgtaacctcagaggattcttac
cgcgatgcaatcggggttcaggagggcgatgagatcgtcgccgtttccttccatattgat
atccaggatgttatgaacagcgattttgtcagcatcctgacatgcagcttggccaaagag
attgtcgaacagatcatgggcaataatcaggagtctctggaaaatatccatgctccggcg
cagccgccagcggccgctgccgcacaggaacagtctgccgcatcaccacagtcggccatg
cagccgccagctgccgccgctgcaccgcagccgcctgtgacacaagccgctccccctcag
ccggccatgcagcagccggcagttgccatggatatggcggcgcagcagccagcgatgcag
cagccggggatgatgccgccggagatgcagcatcccggaatgcagcccgcatatggaatg
ccgccatatggccagatgccgtatggttatccgatgtatccaatgccgccatatccgcag
caggcttatggtatgcaggaaccgcagccggctacacagaagccaatcaatgtacaaaat
acacaatttccgcaatttacagttcaacagacagattcgcccacatcaaacgccaatatg
gatctgttgatgggtgtttcgcttgacgtctctgttgagattggtcaaacaaagcggaag
attaaggatatcattgattttggacagggaactgtcattgagttgaataaacaggcggga
gcgcctgttgatatcgttgtaaatggccgcctgcttgcacgtggcgacgttgtagtgatt
gatgataactttggcgtgcggattaccgagattgtcggcacaaaggaattaatggagagt
ctgaaagaagatgccgtttaa

DBGET integrated database retrieval system