Parazoarcus communis: CEW83_04135 Help Entry CEW83_04135       CDS       T05456                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism acom  Parazoarcus communis Pathway acom01100   Metabolic pathways acom01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acom00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CEW83_04135    00074 Mycolic acid biosynthesis     CEW83_04135   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CEW83_04135 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 DUF1896 DUF5783 Motif Other DBs NCBI-ProteinID:  AWI77496 UniProt:  A0A2U8GWX7 LinkDB All DBs Position 897243..897482 Genome browser AA seq 79 aa AA seqDB search MENIEQRVRKIVAEQLGVNESEIKNESSFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITNVQQAIDYVTAHLKK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagaacatcgaacagcgcgtaagaaagatcgttgctgagcaacttggcgtaaacgaa tcggagatcaagaacgaatcttcgttcgtggatgatctcggcgcagattcgctggacacc gtggaactggtcatggcactggaagaagagttcgagtgcgagattccggacgaagaggcc gagaagatcaccaacgttcaacaggcgattgactacgtcaccgcccacctcaagaagtaa

DBGET integrated database retrieval system