Adelges cooleyi (spruce gall adelgid): 126834751 Help Entry 126834751         CDS       T09500                                  Name (RefSeq) acyl-CoA-binding protein homolog   KO K08762   diazepam-binding inhibitor (GABA receptor modulator, acyl-CoA-binding protein) Organism acoo  Adelges cooleyi (spruce gall adelgid) Brite KEGG Orthology (KO) [BR:acoo00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:acoo04052]     126834751 Cytokines and neuropeptides [BR:acoo04052]  Neuropeptides   Unclassified    126834751 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ACBP Motif Other DBs NCBI-GeneID:  126834751 NCBI-ProteinID:  XP_050422864 LinkDB All DBs Position Unknown AA seq 86 aa AA seqDB search MSFEESVEKVKDLKQTPSDQDLLELYAYFKQASVGDCTTAKPGFLDFKGKAKWEAWNSKK GVGNEEAKAKYVELVNKLIEQHGLKG NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtctttcgaagaatcagtggaaaaagtgaaagacttaaaacaaacaccgagcgatcaa gatttattagaactatacgcctacttcaagcaagcatcagttggcgattgcactacagcc aagcctggctttttggattttaaaggaaaagccaaatgggaggcatggaattccaagaaa ggcgttggtaacgaagaagctaaggccaaatatgttgaattagttaacaagttgatcgaa caacatggtctcaagggctga

DBGET integrated database retrieval system