Adelges cooleyi (spruce gall adelgid): 126837183
Help
Entry
126837183 CDS
T09500
Name
(RefSeq) mitochondrial import inner membrane translocase subunit Tim17-B-like
KO
K17795
mitochondrial import inner membrane translocase subunit TIM17
Organism
acoo
Adelges cooleyi (spruce gall adelgid)
Brite
KEGG Orthology (KO) [BR:
acoo00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03029 Mitochondrial biogenesis [BR:
acoo03029
]
126837183
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
acoo02000
]
126837183
Mitochondrial biogenesis [BR:
acoo03029
]
Mitochondrial protein import machinery
Inner mambrane
TIM23 complex
126837183
Transporters [BR:
acoo02000
]
Other transporters
Primary active transporters [TC:
3
]
126837183
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Tim17
Motif
Other DBs
NCBI-GeneID:
126837183
NCBI-ProteinID:
XP_050426966
LinkDB
All DBs
Position
Unknown
AA seq
164 aa
AA seq
DB search
MGEYAREPCPMRIMEDLGGAFAIGFMGGGIFNGIKGFCNAPTGFRRRFKSAFHSATTRAP
QVGGSFAVWGGVFAAIDCSLVGIRKKEDAWNGIISGGLTGGILSARSGVASMVGSAVFGA
CLLAMIEGYSLWFMQVYETEQYRQQPPIFQDPPPIFKDPPNGKV
NT seq
495 nt
NT seq
+upstream
nt +downstream
nt
atgggcgaatatgcaagagagccatgcccgatgaggattatggaagatcttggtggtgcg
tttgccataggtttcatgggcggaggaattttcaacggaatcaaaggtttctgcaatgca
ccaaccggtttccgtagacgtttcaagagtgcttttcattcggccaccacccgagccccc
caagtgggcggcagttttgcagtttggggaggcgtgttcgcggccattgattgttcgttg
gtgggcataagaaaaaaagaagacgcttggaacggcatcattagcggcggtctgaccggc
ggcatactgtccgcgcgaagcggcgtcgcctcaatggtaggtagcgctgtcttcggggcc
tgtctgttggccatgattgaaggatacagcttgtggttcatgcaagtgtatgaaaccgaa
cagtatcgacaacaacctccgatattccaagatcctcctccaatattcaaagatcctcca
aatggcaaagtctga
DBGET
integrated database retrieval system