Adelges cooleyi (spruce gall adelgid): 126839238 Help Entry 126839238         CDS       T09500                                  Name (RefSeq) calmodulin isoform X1   KO K02183   calmodulin Organism acoo  Adelges cooleyi (spruce gall adelgid) Pathway acoo04070   Phosphatidylinositol signaling system acoo04745   Phototransduction - fly Brite KEGG Orthology (KO) [BR:acoo00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     126839238  09150 Organismal Systems   09157 Sensory system    04745 Phototransduction - fly     126839238  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:acoo01009]     126839238   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:acoo04131]     126839238    03036 Chromosome and associated proteins [BR:acoo03036]     126839238   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acoo04147]     126839238 Protein phosphatases and associated proteins [BR:acoo01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      126839238 Membrane trafficking [BR:acoo04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     126839238 Chromosome and associated proteins [BR:acoo03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      126839238 Exosome [BR:acoo04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    126839238 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 Dockerin_1 EFhand_Ca_insen DUF1103 FCaBP_EF-hand Caleosin TerB DUF5580_M Poly_export SPEF2_C MotA_activ Fe_hyd_lg_C SurA_N_3 DUF2267 PA_Ig-like Motif Other DBs NCBI-GeneID:  126839238 NCBI-ProteinID:  XP_050430366 LinkDB All DBs Position Unknown AA seq 150 aa AA seqDB search MLADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD GNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTD EEVDEMIREADIDGDGQVNYEEFVTMMTSK NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgctggctgatcaactaactgaagaacaaattgctgaattcaaagaagcgttctcgctc tttgacaaggatggtgatggtaccattaccaccaaagaactgggaaccgtcatgaggtct cttggccaaaacccgactgaagctgaactccaagacatgatcaatgaagttgatgctgat ggaaacggtacgatagacttcccagagttcttgaccatgatggcccgtaaaatgaaagac accgacagcgaggaagaaatcagagaggctttccgtgtctttgacaaggacggaaacggt ttcatcagtgcagctgaactgcgtcatgtaatgacaaaccttggtgagaagctcaccgac gaagaggtagatgagatgatcagggaggctgacattgacggtgatggtcaagtcaactat gaagagttcgtgaccatgatgacttctaagtga

DBGET integrated database retrieval system