Adelges cooleyi (spruce gall adelgid): 126844364 Help Entry 126844364         CDS       T09500                                  Name (RefSeq) autophagy protein 12-like   KO K08336   ubiquitin-like protein ATG12 Organism acoo  Adelges cooleyi (spruce gall adelgid) Pathway acoo04068   FoxO signaling pathway acoo04136   Autophagy - other acoo04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:acoo00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     126844364  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     126844364    04136 Autophagy - other     126844364  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:acoo04131]     126844364    04121 Ubiquitin system [BR:acoo04121]     126844364    03029 Mitochondrial biogenesis [BR:acoo03029]     126844364 Membrane trafficking [BR:acoo04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     126844364 Ubiquitin system [BR:acoo04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    126844364 Mitochondrial biogenesis [BR:acoo03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     126844364 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  126844364 NCBI-ProteinID:  XP_050438470 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MESSVSETNKPPGPENKEKIEILLKATGNAPILKTKKWMVEKEKTVAAINEFLRKLLKLD PSDSLFLYVNQAFAPSPDQTMKNLYDCYNTNGRVVLYYCKTQAWG NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggaatcttctgtaagtgaaactaataaaccaccgggtccagaaaataaagaaaaaatt gaaatattgttaaaagcaactggaaacgcaccaattttgaagaccaaaaagtggatggtc gaaaaggaaaaaacagtagctgcaataaatgagttcctgcgtaaattattgaaactagat ccatctgattccttatttttatatgttaatcaagcgtttgctccatctccggaccagaca atgaaaaatctttatgattgttacaacacaaatggtcgcgttgttctttattactgcaaa acacaagcttggggataa

DBGET integrated database retrieval system