Adelges cooleyi (spruce gall adelgid): 126845728 Help Entry 126845728         CDS       T09500                                  Name (RefSeq) GTPase HRas   KO K07827   GTPase KRas Organism acoo  Adelges cooleyi (spruce gall adelgid) Pathway acoo04013   MAPK signaling pathway - fly acoo04068   FoxO signaling pathway acoo04137   Mitophagy - animal acoo04140   Autophagy - animal acoo04150   mTOR signaling pathway acoo04213   Longevity regulating pathway - multiple species acoo04214   Apoptosis - fly acoo04320   Dorso-ventral axis formation acoo04519   Cadherin signaling Brite KEGG Orthology (KO) [BR:acoo00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     126845728    04068 FoxO signaling pathway     126845728    04150 mTOR signaling pathway     126845728   09133 Signaling molecules and interaction    04519 Cadherin signaling     126845728  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     126845728    04137 Mitophagy - animal     126845728   09143 Cell growth and death    04214 Apoptosis - fly     126845728  09150 Organismal Systems   09158 Development and regeneration    04320 Dorso-ventral axis formation     126845728   09149 Aging    04213 Longevity regulating pathway - multiple species     126845728  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:acoo04131]     126845728   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:acoo04031]     126845728 Membrane trafficking [BR:acoo04131]  Endocytosis   Macropinocytosis    Ras GTPases     126845728 GTP-binding proteins [BR:acoo04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     126845728 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin ATP_bind_1 CdhD Ldh_1_N Motif Other DBs NCBI-GeneID:  126845728 NCBI-ProteinID:  XP_050440537 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDISNYREQIKRVKDAEDVPMVLVGNKCDL QSRAIDVKGASDLAKQYGVPFIETSAKTRQGVDDAFYTLVREIRKDKEQRLREKRKAKPR RKRKHCYLF NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatacaaactggtcgtcgtcggtgctggcggcgtcggtaaaagtgccttaaca atacagttgatacaaaaccactttgtggacgagtatgatcctacaattgaggattcttat cgtaagcaagtagtaattgatggagaaacgtgtctacttgatattttggacacggcgggt caagaggaatacagtgctatgcgagatcaatacatgagaactggtgaaggttttcttctt gtatttgctataaataatacaaaatcatttgaagacattagtaactacagggagcagata aaacgagtaaaagatgctgaagatgtccccatggttttggtgggtaataaatgtgatctg caaagtagagcaatagatgtaaaaggagcatctgatttagctaaacaatacggtgtgccg ttcatcgagacatctgccaaaacgagacaaggtgttgacgatgcattctacactctggtc agagaaattaggaaagacaaagaacaaaggctgcgagagaaacgcaaagcaaaaccccga aggaaacgcaagcattgttacctgttctga

DBGET integrated database retrieval system