Anopheles coustani: 131263065 Help Entry 131263065         CDS       T10908                                  Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism acos  Anopheles coustani Pathway acos03030   DNA replication acos03082   ATP-dependent chromatin remodeling acos03410   Base excision repair acos03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:acos00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     131263065    03410 Base excision repair     131263065    03420 Nucleotide excision repair     131263065   09126 Chromosome    03082 ATP-dependent chromatin remodeling     131263065  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:acos03032]     131263065    03036 Chromosome and associated proteins [BR:acos03036]     131263065    03400 DNA repair and recombination proteins [BR:acos03400]     131263065 Enzymes [BR:acos01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      131263065 DNA replication proteins [BR:acos03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     131263065 Chromosome and associated proteins [BR:acos03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     131263065 DNA repair and recombination proteins [BR:acos03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       131263065 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF NAD_Gly3P_dh_N Histone Motif Other DBs NCBI-GeneID:  131263065 NCBI-ProteinID:  XP_058121191 LinkDB All DBs Position 2:81899621..81900248 Genome browser AA seq 127 aa AA seqDB search MVERIEDLNLPNTSVTRLMKEAIPADVKISTECRTALTRATSVFVLYLTSAATTAAQQRN HKSLMADHVLKGLEEIEFESFIQPLKTELESYRKMIKTKKEKKAAKAELNTTVEGAVIDL ENMAQDN NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atggttgaacgcatagaagatctgaatttacctaacacctccgtgacaaggttgatgaag gaagccattccggccgatgtgaaaatatcgaccgaatgtcggacagcattaacccgggca acctcggtgtttgtgctatatctaacgtcggcggccacaactgccgcgcagcaaagaaat cacaaatcactcatggcggaccatgttttgaagggcctggaagagattgaattcgaaagc tttatccaaccgctgaaaaccgagctggaaagttacaggaaaatgataaaaacgaaaaag gagaagaaagcggctaaagctgaactgaacacaacggtagaaggagcggtaatagatctt gaaaacatggctcaggacaattaa

DBGET integrated database retrieval system