KEGG   Anopheles coustani: 131266785
Entry
131266785         CDS       T10908                                 
Name
(RefSeq) putative sodium-coupled neutral amino acid transporter 11
  KO
K14997  solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 11
Organism
acos  Anopheles coustani
Brite
KEGG Orthology (KO) [BR:acos00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acos02000]
    131266785
Transporters [BR:acos02000]
 Solute carrier family (SLC)
  SLC38: System A and System N sodium-coupled neutral amino acid transporter
   131266785
SSDB
Motif
Pfam: Aa_trans Trp_Tyr_perm
Other DBs
NCBI-GeneID: 131266785
NCBI-ProteinID: XP_058125414
LinkDB
Position
2:57909594..57934952
AA seq 500 aa
MESASTKKNTVSEFSYMLQRQGSDDSAEVNAFDDINSLMKREANQGKQTEALSSLPQASF
NYINSIVGSGVIGIPYALHRAGFGLGLFLLVIVATITDYSLILMVRCGHLCGRFSYPGVM
EAAYGKGGYYLLSLLQFMYPFLAMISYNVVVGDTLSKVLVRFVPSWGSSMGAVRFGVVLV
VTIFVVIPLCLYKNVSRLAKASFLSLACVVLILMAVVYKLLSGDYRVVPDTPESWRFAHS
DLIPAVGIMAFAFMCHHNTFLVHQSMQDATMERWEKVTHISVGFAWLVAALFGIAGYCTF
RALSQGDLLENYCWDDDLMNFARVLFSISILLTFPIECFVSREIVRTQIKRFYSQEVVEY
DTDKDPSHVTGEDDDRKSMITTLVIVFAAFIISPYTECLGPVLELNGLLAAIPLAYVLPG
LAYIRLSPHSLFSQEKLPALGLVVFGTIVTISGAAILMPNLIGDCRTGIIMGYCKDDELA
TNGTAFATSTMEPNCATDKI
NT seq 1503 nt   +upstreamnt  +downstreamnt
atggaatccgccagcactaagaagaacaccgtgtcggagtttagttacatgctgcagcga
caaggcagtgatgactcggctgaagtgaatgcattcgatgacatcaactcgttgatgaag
agggaggcgaaccagggtaaacagaccgaagccttatcgtcgctcccgcaagcatccttc
aactacatcaattcaatcgtcggcagcggcgtcatcggcatcccgtacgcgctccatcgg
gccggcttcgggcttggtctctttctactggtgatcgtcgccacgataacggactactcg
ttgattttgatggtacgctgcggacacctgtgcggacgattcagctatccgggcgtgatg
gaagctgcttatgggaagggtggctactatctgctatcgttgctgcaatttatgtacccc
tttctagcgatgatatcgtacaacgtcgtcgtgggggacacgctctcgaaggtgctggtg
cgcttcgtgccgtcctggggcagctcgatgggtgcggtgcggttcggggtggtgctggtc
gtcaccatcttcgtcgtgataccgctctgcctgtacaagaacgtgtcccggctggcaaag
gcaagctttcttagtctggcctgcgtggtgctcatactgatggccgtcgtttacaagctg
ctgtcgggcgattaccgagtcgtccccgatacaccagagtcctggcgattcgctcacagc
gatctcattccagccgttggtataatggcatttgcgttcatgtgccaccataacacgttc
ctcgtgcaccagtcgatgcaggacgctaccatggagcgctgggagaaggtgacccacatt
tcggtcggcttcgcatggctcgtggcggcacttttcggtatcgccggatactgcaccttt
cgggcactttcgcaaggggatctgctggaaaactactgctgggacgacgatctgatgaat
ttcgcccgcgtgctgttctctatctcaattctgctgacgttccccatcgagtgcttcgtg
tcgcgggaaattgtccgtacgcagatcaagcgcttctactcacaggaggtcgtcgagtac
gacaccgacaaggacccgagccacgtgaccggcgaagacgacgaccgcaagtcgatgatc
acgaccctcgtcatcgtattcgcagcattcattatctcaccttacaccgagtgtcttgga
ccggtgctggaattgaacggcttactagcagcaatcccactggcatacgttcttcccgga
ctggcctacattcggctgagccctcactcactgttcagtcaggagaaactgccggccttg
ggtctagtggtattcggcacgatcgtcaccatttccggtgcggccatcctgatgccgaac
ctgatcggcgattgtcggacgggtattatcatgggatactgcaaggatgacgagcttgct
accaacggtacggcatttgcgacgtccacgatggagcccaattgtgcaacggacaagata
taa

DBGET integrated database retrieval system