Alistipes communis: A5CBH24_24450 Help Entry A5CBH24_24450     CDS       T06592                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism acou  Alistipes communis Pathway acou00020   Citrate cycle (TCA cycle) acou00720   Other carbon fixation pathways acou01100   Metabolic pathways acou01110   Biosynthesis of secondary metabolites acou01120   Microbial metabolism in diverse environments acou01200   Carbon metabolism acou01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:acou00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     A5CBH24_24450   09102 Energy metabolism    00720 Other carbon fixation pathways     A5CBH24_24450 Enzymes [BR:acou01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      A5CBH24_24450 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_21 Fer4_7 Fer4_6 Fer4_10 Fer4_4 Fer4_9 Fer4_16 Fer4_15 Fer4_13 Fer4_3 Fer4_8 Motif Other DBs NCBI-ProteinID:  BBL05132 UniProt:  A0A3D3YNJ6 LinkDB All DBs Position complement(3046127..3046354) Genome browser AA seq 75 aa AA seqDB search MAKIKGTIVVDKERCKGCGVCVASCPCDVLALSVEVNNKGYRMCMMAHPDACTGCASCAI ICPDSCITVYRQKFE NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcaaagataaaaggaacgattgtcgttgataaagaacgctgtaagggttgcggcgtc tgcgtggcatcgtgtccgtgcgacgtgctggccctttcggtcgaagtcaacaacaagggg tatcgcatgtgcatgatggcgcaccccgacgcctgtacgggctgcgcttcgtgtgcgatc atctgtccggacagttgtattacggtataccggcaaaaattcgaatag

DBGET integrated database retrieval system