KEGG   Anopheles coluzzii: 120948058
Entry
120948058         CDS       T07312                                 
Name
(RefSeq) LOW QUALITY PROTEIN: cytochrome P450 306a1-like
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
acoz  Anopheles coluzzii
Pathway
acoz00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:acoz00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    120948058
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:acoz00199]
    120948058
Enzymes [BR:acoz01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     120948058
Cytochrome P450 [BR:acoz00199]
 Cytochrome P450, animal type
  CYP306 family
   120948058
SSDB
Motif
Pfam: p450 DUF22
Other DBs
NCBI-GeneID: 120948058
NCBI-ProteinID: XP_040219966
LinkDB
Position
2:complement(58910531..58976197)
AA seq 375 aa
MVKYGCARLNLERRINSGLIEMLQDIDNMVDKAPQGLNPSPIIHHVLGNLLNDLVFGIKY
EKNNVTWKYLQHLQEEGVKHIGVSMAVNFLPFLRYLPSTRRTINFLLSGKHQTHAIYDAL
ISHQRSKLRSCDTFIEEQEECILTYFLKEAAKRQEAGRPDAAFCDDIQLRHLMADLFGAG
VDTTFTTIRWALLYIALYPTVQKRLREELRQRLVVNEPPSLKDVEALPYLRATIAEVQRI
RTVVPLGIPHGTTKEIKIGDFKIPSNTMIMPVVWAVHMNPILFNAPNTFKPERFLDLEGR
FSIQTXFLPFQVGKRMCLGEELARNILHLYIANIVYHYDWIRISPEDAMLIDLTGNCGLT
LTPPDYIIIFSKNNK
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggttaagtatggatgtgctcgattaaatcttgaacggagaattaattctggacttatc
gaaatgcttcaggacattgataatatggtagataaggcaccacaaggtttaaacccatct
cctatcatacatcacgtgctcggaaatttattaaatgatttagtttttggtataaaatac
gaaaagaacaatgttacatggaaatatttacagcaccttcaagaagaaggtgtgaagcat
attggagtatctatggctgtgaacttcttaccatttttgagatatttaccttctactcgt
agaacaatcaattttcttctcagtggaaaacatcaaacacatgctatttatgatgctttg
atatcccatcaacgaagcaagttgcgttcttgtgatacatttattgaagagcaggaggag
tgcatattaacatattttttaaaagaagccgcaaaacgacaagaagcaggtcgaccggat
gctgcattttgcgatgacatacagctacgccatttgatggcagacttgttcggggcaggt
gtggatactacatttactacgattcgatgggctttgctatatatcgccctatatccaact
gttcaaaagcgtcttcgagaagaactgagacaaagactggtcgtgaatgagccaccttcg
ttgaaagatgtggaggctttgccctatttacgggcaaccatcgcggaagtgcagcgaatt
cgtaccgttgttccgcttggtatacctcatggaacaactaaggaaataaagattggtgat
tttaaaattccatcaaatacaatgatcatgcctgtagtatgggctgtgcacatgaatcct
atactattcaacgcgccaaacactttcaagccagaacggttcctggatttagaggggcgc
ttctccattcaaactnactttcttccatttcaagtcggtaaacgtatgtgtttgggcgaa
gagcttgctagaaatattcttcatttgtacatcgccaatatagtgtatcattacgattgg
attcggatatctcctgaggatgctatgttgattgatttaacaggaaattgtggattaacc
ttaactcccccagactatataattatattctcgaaaaataataaataa

DBGET integrated database retrieval system