Anopheles coluzzii: 120948711 Help Entry 120948711         CDS       T07312                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism acoz  Anopheles coluzzii Pathway acoz04013   MAPK signaling pathway - fly acoz04145   Phagosome acoz04148   Efferocytosis acoz04310   Wnt signaling pathway acoz04620   Toll-like receptor signaling pathway acoz05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:acoz00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     120948711    04310 Wnt signaling pathway     120948711  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     120948711    04148 Efferocytosis     120948711  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120948711  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     120948711  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:acoz04131]     120948711   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acoz04147]     120948711    04031 GTP-binding proteins [BR:acoz04031]     120948711 Membrane trafficking [BR:acoz04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     120948711  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     120948711   Macropinocytosis    Ras GTPases     120948711  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     120948711 Exosome [BR:acoz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120948711   Exosomal proteins of other body fluids (saliva and urine)    120948711   Exosomal proteins of colorectal cancer cells    120948711   Exosomal proteins of bladder cancer cells    120948711 GTP-binding proteins [BR:acoz04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     120948711 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  120948711 NCBI-ProteinID:  XP_040221286 UniProt:  A0A182LJR5 LinkDB All DBs Position 2:complement(81559329..81568850) Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPNIPIILVGTKLDLR DDKNTVDKLRDKKLSPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPM IPPKKKPKCNIL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgatcaaatgtgtcgtcgtcggtgacggtgccgtcggtaagacgtgcctgctg atcagctacacaacgaacgcgttcccgggcgagtacatcccgaccgtgttcgacaactac tccgcgaacgtgatggtcgacggcaaaccgatcaacctcgggctgtgggatacggccggg caggaggattacgatcggctgcggcccctgtcctacccgcagacggacgtgtttctcata tgcttctcgctcgtcaatccggcctcgttcgagaacgtgcgggcgaaatggtacccggag gtgcgccaccactgtccgaacataccgatcatactggtcgggacgaagctcgatctgcgg gatgacaagaacacggtggacaagctgcgggacaagaagctgtcgccgatcacgtacccg caggggctggccatggccaaggagatcggtgcggtcaagtacctcgagtgttcggcgctg acgcagaagggcctcaagacggtgttcgacgaagcgatccgggcggtgctctgtccgatg attccgccgaagaagaaacccaagtgtaacatcctctaa

DBGET integrated database retrieval system