Anopheles coluzzii: 120948711 Help Entry 120948711         CDS       T07312                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism acoz  Anopheles coluzzii Pathway acoz04013   MAPK signaling pathway - fly acoz04145   Phagosome acoz04148   Efferocytosis acoz04310   Wnt signaling pathway acoz04517   IgSF CAM signaling acoz04518   Integrin signaling acoz04620   Toll-like receptor signaling pathway acoz05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:acoz00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     120948711    04310 Wnt signaling pathway     120948711   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     120948711    04518 Integrin signaling     120948711  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     120948711    04148 Efferocytosis     120948711  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120948711  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     120948711  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:acoz04131]     120948711   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acoz04147]     120948711    04031 GTP-binding proteins [BR:acoz04031]     120948711 Membrane trafficking [BR:acoz04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     120948711  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     120948711   Macropinocytosis    Ras GTPases     120948711  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     120948711 Exosome [BR:acoz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120948711   Exosomal proteins of other body fluids (saliva and urine)    120948711   Exosomal proteins of colorectal cancer cells    120948711   Exosomal proteins of bladder cancer cells    120948711 GTP-binding proteins [BR:acoz04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     120948711 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  120948711 NCBI-ProteinID:  XP_040221286 UniProt:  A0A182LJR5 LinkDB All DBs Position 2:complement(81559329..81568850) Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPNIPIILVGTKLDLR DDKNTVDKLRDKKLSPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPM IPPKKKPKCNIL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgatcaaatgtgtcgtcgtcggtgacggtgccgtcggtaagacgtgcctgctg atcagctacacaacgaacgcgttcccgggcgagtacatcccgaccgtgttcgacaactac tccgcgaacgtgatggtcgacggcaaaccgatcaacctcgggctgtgggatacggccggg caggaggattacgatcggctgcggcccctgtcctacccgcagacggacgtgtttctcata tgcttctcgctcgtcaatccggcctcgttcgagaacgtgcgggcgaaatggtacccggag gtgcgccaccactgtccgaacataccgatcatactggtcgggacgaagctcgatctgcgg gatgacaagaacacggtggacaagctgcgggacaagaagctgtcgccgatcacgtacccg caggggctggccatggccaaggagatcggtgcggtcaagtacctcgagtgttcggcgctg acgcagaagggcctcaagacggtgttcgacgaagcgatccgggcggtgctctgtccgatg attccgccgaagaagaaacccaagtgtaacatcctctaa

DBGET integrated database retrieval system