Actinomyces sp. oral taxon 414: AM609_02250 Help Entry AM609_02250       CDS       T04083                                  Name (GenBank) molecular chaperone GroES   KO K04078   chaperonin GroES Organism acq  Actinomyces sp. oral taxon 414 Brite KEGG Orthology (KO) [BR:acq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:acq03110]     AM609_02250    03029 Mitochondrial biogenesis [BR:acq03029]     AM609_02250 Chaperones and folding catalysts [BR:acq03110]  Heat shock proteins   HSP10    AM609_02250 Mitochondrial biogenesis [BR:acq03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     AM609_02250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  ALC98591 UniProt:  A0A0M4GD03 LinkDB All DBs Position 566121..566417 Genome browser AA seq 98 aa AA seqDB search MAISIKPLEDRIVVQTLEAEQTTASGLVIPDTAKEKPQEGKVLAVGPGRVDDSGKRIPVD VAEGDVVIYSKYGGTEIKYQGEEYLILSARDVLAVVTK NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggcgatctccatcaagccgctcgaggaccgcattgtcgtccagacgctcgaggccgag cagaccaccgcctccggcctggtcattccggacaccgccaaggagaagccgcaggagggc aaggtcctggccgtgggccccggccgcgtggacgactccggcaagcgcatcccggtcgac gtcgccgagggcgacgtggtcatctactccaagtacggcggcaccgagatcaagtaccag ggtgaggagtatctcatcctctccgcgcgcgacgtcctggccgtcgtcaccaagtga

DBGET integrated database retrieval system