Acidovorax sp. RAC01: BSY15_3265 Help Entry BSY15_3265        CDS       T04481                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism acra  Acidovorax sp. RAC01 Brite KEGG Orthology (KO) [BR:acra00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:acra03036]     BSY15_3265    03400 DNA repair and recombination proteins [BR:acra03400]     BSY15_3265 Chromosome and associated proteins [BR:acra03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BSY15_3265 DNA repair and recombination proteins [BR:acra03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BSY15_3265 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  AOG22064 UniProt:  A0A1B3PH29 LinkDB All DBs Position 3645347..3645622 Genome browser AA seq 91 aa AA seqDB search MSSYAELLAQKKLLDEQIANARKAESEQALQTVLQLVQEFGFTAQQVFPWKPQPKKVAAK YRDPDTGATWSGRGKPPQWIAGKDRTPFVIA NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgtccagctacgccgaactcctcgcccagaaaaaactcctcgacgaacaaatcgccaac gccaggaaggccgagtccgaacaggccctccaaaccgttctgcaactcgttcaggagttc ggattcaccgcccagcaagtcttcccttggaagccccagcccaagaaggtcgctgccaag taccgcgaccccgataccggtgctacctggtccggccggggcaagccgccccagtggatt gcgggcaaggaccgcacgccctttgtgattgcctga

DBGET integrated database retrieval system