Aliarcobacter cryaerophilus: ACRYA_0232 Help Entry ACRYA_0232        CDS       T06825                                  Symbol acpP1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism acre  Aliarcobacter cryaerophilus Pathway acre01100   Metabolic pathways acre01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acre00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACRYA_0232 (acpP1)    00074 Mycolic acid biosynthesis     ACRYA_0232 (acpP1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACRYA_0232 (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  AYJ79395 UniProt:  A0AAD0TUW9 LinkDB All DBs Position complement(247892..248122) Genome browser AA seq 76 aa AA seqDB search MALLDDVKAVVVDQLDCDPAEVKEDSKFIEDLGADSLDVVELVMALEEKFDIEIPDEEAE KILTVGDAISYIENNK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcattattagatgatgtaaaagctgttgttgttgatcaattagattgcgatccagct gaagttaaagaagattcaaagttcattgaagacttaggagcagattcactagatgttgtg gagcttgtaatggctttagaagagaaatttgatatcgaaatccctgatgaagaagctgaa aaaatattaactgttggtgatgcaatatcatacattgaaaacaataaatag

DBGET integrated database retrieval system