Aliiroseovarius crassostreae: K3J57_05100 Help Entry K3J57_05100       CDS       T08444                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism acro  Aliiroseovarius crassostreae Pathway acro01100   Metabolic pathways acro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acro00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K3J57_05100    00074 Mycolic acid biosynthesis     K3J57_05100   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K3J57_05100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  UWP90058 LinkDB All DBs Position 1055666..1055899 Genome browser AA seq 77 aa AA seqDB search MSDVADRVKKIVVEHLGVEEDKVTESASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFITEAQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgtcgcagatcgcgtgaaaaaaatcgttgttgagcacctgggtgtggaagag gacaaggtcacggaatcggcctcgttcattgacgacctgggcgcagacagcctggacacc gttgagctggttatggctttcgaagaagagttcggcattgagatcccggatgacgctgcc gaaaccatccagaccttcggcgacgccgtaaagttcatcaccgaagctcaataa

DBGET integrated database retrieval system