Aliiroseovarius crassostreae: K3J57_05755 Help Entry K3J57_05755       CDS       T08444                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism acro  Aliiroseovarius crassostreae Pathway acro01100   Metabolic pathways acro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acro00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K3J57_05755    00074 Mycolic acid biosynthesis     K3J57_05755   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K3J57_05755 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  UWP90172 LinkDB All DBs Position 1199643..1199906 Genome browser AA seq 87 aa AA seqDB search MSDIRDRVIAIIAEQAVLEPGDVRPEQTLEELGIDSLGLVESIFAIEEAFDISVPFNAND PEESGFDISSVAAIIAAVEGLIAAQAA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgtctgacataagggaccgggtgattgcgatcatcgctgaacaggccgtgctggagccg ggggatgtgcgccccgagcagacgcttgaggagctgggcattgacagtctcggactggtc gaaagtatctttgccatcgaagaagcctttgatatttcagtgcctttcaatgccaacgac cctgaggaaagcgggtttgacatctcttccgtggcggcgatcatcgcggctgtcgaaggc ttgattgctgcgcaggcagcctga

DBGET integrated database retrieval system