Alysiella crassa: LVJ80_07760 Help Entry LVJ80_07760       CDS       T08264                                  Symbol groES Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism acrs  Alysiella crassa Brite KEGG Orthology (KO) [BR:acrs00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:acrs03110]     LVJ80_07760 (groES)    03029 Mitochondrial biogenesis [BR:acrs03029]     LVJ80_07760 (groES) Chaperones and folding catalysts [BR:acrs03110]  Heat shock proteins   HSP10    LVJ80_07760 (groES) Mitochondrial biogenesis [BR:acrs03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     LVJ80_07760 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 DUF7205 ExoX-like_C Motif Other DBs NCBI-ProteinID:  UOP05792 LinkDB All DBs Position 497493..497780 Genome browser AA seq 95 aa AA seqDB search MNIRPLHDRVVIKRLEAEEKTSSGIILAPSATEKPDMGEVIAIGEGKIGRDGNRRPLDVK VGDKVIFGKYSGQTVKVDGEELLVMKEEDIFGVIA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaatatccgtcctttacacgaccgtgttgtcatcaaacgcttggaagcggaagaaaaa accagctctggcatcattttagcccccagcgcaaccgaaaaacccgatatgggcgaagtg attgcaattggcgaaggcaaaattggtcgcgatggcaaccgccgtccattagacgtgaaa gtaggcgacaaagtgattttcggcaaatattcaggtcaaaccgtaaaagtggacggcgaa gaattgctggtcatgaaagaagaagacatttttggcgtgattgcttga

DBGET integrated database retrieval system