Alysiella crassa: LVJ80_09760 Help Entry LVJ80_09760       CDS       T08264                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism acrs  Alysiella crassa Pathway acrs01100   Metabolic pathways acrs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acrs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LVJ80_09760    00074 Mycolic acid biosynthesis     LVJ80_09760   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LVJ80_09760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 DUF7463 DUF1805 Motif Other DBs NCBI-ProteinID:  UOP06112 LinkDB All DBs Position 92843..93100 Genome browser AA seq 85 aa AA seqDB search MNEQEIRQILLDALESLFEVDISQVSGSTHLYEDLEIDSIDAIDLIDHIKRQTGHKLQAE DFRAVRTVDDVVAAVLKKQNQQANS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaatgaacaagaaattcgccaaattttattggacgcattggaaagtctatttgaagtg gacatcagtcaagtgtcaggcagcacccatttatacgaagatttggaaattgacagcatt gacgcgattgacttaattgaccacatcaaacgtcaaacaggacacaaattgcaagccgaa gatttccgcgctgtgcgtacggtggacgatgtggtcgccgccgtattaaaaaagcaaaat caacaggctaactcatga

DBGET integrated database retrieval system