Crystallibacter crystallopoietes: AC20117_19995 Help Entry AC20117_19995     CDS       T05322                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism acry  Crystallibacter crystallopoietes Pathway acry00998   Biosynthesis of various antibiotics acry01100   Metabolic pathways acry01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acry00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AC20117_19995    00074 Mycolic acid biosynthesis     AC20117_19995   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AC20117_19995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Ag332 Motif Other DBs NCBI-ProteinID:  AUI52738 UniProt:  A0A1H1G6A1 LinkDB All DBs Position 4335185..4335430 Genome browser AA seq 81 aa AA seqDB search MASNEEILAGLAEIVNEETGLAPEAVELDKSFTDDLDIDSISMMTIVVNAEEKFGVRIPD EEVKNLKTVGDAVDFIANAQA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggctagcaacgaagaaatcctggcaggcctggccgaaatcgttaacgaggaaaccggc ctcgcacccgaagctgtcgagctggacaagtccttcaccgacgatctggacattgactcc atctccatgatgacgatcgtcgtcaacgctgaggaaaagttcggcgtccgcatccccgat gaagaggtcaagaacctcaagaccgtcggcgacgccgtggacttcatcgccaacgcccag gcgtaa

DBGET integrated database retrieval system