Anolis carolinensis (green anole): 100552074 Help Entry 100552074         CDS       T01608                                  Symbol sec61b Name (RefSeq) Sec61 translocon beta subunit   KO K09481   protein transport protein SEC61 subunit beta Organism acs  Anolis carolinensis (green anole) Pathway acs03060   Protein export acs04141   Protein processing in endoplasmic reticulum acs04145   Phagosome Brite KEGG Orthology (KO) [BR:acs00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     100552074 (sec61b)    04141 Protein processing in endoplasmic reticulum     100552074 (sec61b)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     100552074 (sec61b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:acs04131]     100552074 (sec61b)   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:acs02044]     100552074 (sec61b) Membrane trafficking [BR:acs04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     100552074 (sec61b) Secretion system [BR:acs02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    100552074 (sec61b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-GeneID:  100552074 NCBI-ProteinID:  XP_003222286 Ensembl:  ENSACAG00000009059 UniProt:  G1KIE1 LinkDB All DBs Position 6:complement(55622014..55626693) Genome browser AA seq 96 aa AA seqDB search MPGPNPSATSVGASGRSPSKAVAPRAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYT EDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgccgggcccaaaccccagtgcaaccagcgtgggtgcctctggccgctccccaagtaag gcagttgccccgagagctgcaggctccacagtccggcaaagaaaaaatgccagctgcgga acaaggagtgcaggccgtaccacttctgcaggcactggagggatgtggagattctataca gaggattcccctggcctcaaagtgggcccggttccagttcttgttatgagccttctcttt attgcatctgtatttatgttgcacatctggggcaaatatactcggtcgtag

DBGET integrated database retrieval system