Anolis carolinensis (green anole): 100553348 Help Entry 100553348         CDS       T01608                                  Symbol urm1 Name (RefSeq) ubiquitin related modifier 1   KO K12161   ubiquitin related modifier 1 Organism acs  Anolis carolinensis (green anole) Pathway acs04122   Sulfur relay system Brite KEGG Orthology (KO) [BR:acs00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04122 Sulfur relay system     100553348 (urm1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:acs03016]     100553348 (urm1)    04121 Ubiquitin system [BR:acs04121]     100553348 (urm1) Transfer RNA biogenesis [BR:acs03016]  Eukaryotic type   tRNA modification factors    Thiolation factors     100553348 (urm1) Ubiquitin system [BR:acs04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    100553348 (urm1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Urm1 ThiS Motif Other DBs NCBI-GeneID:  100553348 NCBI-ProteinID:  XP_003229741 Ensembl:  ENSACAG00000010428 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MAAPVSLQLEFGGGAELLFDGIKKHQVTLPSQPEPWDVRRLLMWIKENLLKERPELFVQG DSVRPGILVLINDSDWELMGELDYQLQDQDNVVFLSTLHGG NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggcggcgcccgtctcccttcagctggagtttggaggtggagcagaactcttgttcgat gggataaaaaagcaccaggtgactttacccagccagcctgaaccttgggatgttcggcgc ctgctcatgtggattaaagagaacctattgaaagagaggccagagctgtttgtgcaagga gactctgtgcggccgggaatcttggtcctcatcaatgactctgactgggagctgatgggg gagctggactaccaactccaagaccaggataatgtggttttcctctccaccttacacggg ggttag

DBGET integrated database retrieval system