Anolis carolinensis (green anole): 100555151 Help Entry 100555151         CDS       T01608                                  Name (RefSeq) cystatin-B-like   KO K13907   cystatin-A/B Organism acs  Anolis carolinensis (green anole) Brite KEGG Orthology (KO) [BR:acs00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:acs01002]     100555151   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acs04147]     100555151 Peptidases and inhibitors [BR:acs01002]  Peptidase inhibitors   Family I25: cystatin family    100555151 Exosome [BR:acs04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    100555151 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Dynein_light AAA_lid_NAV1 Motif Other DBs NCBI-GeneID:  100555151 NCBI-ProteinID:  XP_003224104 Ensembl:  ENSACAG00000000473 LinkDB All DBs Position Un Genome browser AA seq 98 aa AA seqDB search MKCGGTSETKPATEETQQIVQHVKAQVEEKEGKSFDVFTAVEFKTQMVAGINYFIKVHVG NDQFLHVRIFKSLPHENKPPELTSYQSKKGKHDELSYF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaagtgtggcgggacctcagagaccaagccagccactgaagagacacagcagattgtc cagcacgtcaaggcccaagtggaagagaaagaaggcaagagctttgatgtcttcactgca gtcgagtttaaaacccagatggttgctggaataaactacttcatcaaggtccatgttggg aatgaccaattccttcatgtgcgaatcttcaaaagcctccctcatgagaacaagccaccg gagctcaccagctaccaaagcaagaaaggaaagcacgatgaactgtcctatttctag

DBGET integrated database retrieval system