Anolis carolinensis (green anole): 100555650 Help Entry 100555650         CDS       T01608                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism acs  Anolis carolinensis (green anole) Brite KEGG Orthology (KO) [BR:acs00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:acs03041]     100555650   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:acs04052]     100555650 Spliceosome [BR:acs03041]  Complex B   Other components    Complex B specific factors     100555650 Cytokines and neuropeptides [BR:acs04052]  Neuropeptides   Unclassified    100555650 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 CPDase Motif Other DBs NCBI-GeneID:  100555650 NCBI-ProteinID:  XP_016846268 LinkDB All DBs Position 2:complement(56333562..56333947) Genome browser AA seq 77 aa AA seqDB search HQIGIIEVVCNDHLGKKVRVKCNSDDTIWDLKKLIAAQIGTWWDKTLLKKWYTIFKDHVS LADYEIHDGMNLELYYQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt caccagatcgggataattgaagtggtttgcaatgatcatctgggcaaaaaagtgagagtc aagtgcaactctgatgacaccatttgggacctgaaaaagctcatagctgctcagattgga acttggtgggacaagactttgctaaagaaatggtacacaattttcaaggaccatgtgtca ctggcagactatgaaatccatgatggcatgaacctagaactatactatcagtaa

DBGET integrated database retrieval system