Anolis carolinensis (green anole): 100555886 Help Entry 100555886         CDS       T01608                                  Name (RefSeq) histone H2A type 1-E   KO K11251   histone H2A Organism acs  Anolis carolinensis (green anole) Pathway acs03082   ATP-dependent chromatin remodeling acs04217   Necroptosis Brite KEGG Orthology (KO) [BR:acs00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     100555886  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100555886  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:acs03036]     100555886   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acs04147]     100555886 Chromosome and associated proteins [BR:acs03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100555886 Exosome [BR:acs04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100555886 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  100555886 NCBI-ProteinID:  XP_003227269 Ensembl:  ENSACAG00000003381 UniProt:  L7MTM8 LinkDB All DBs Position Un Genome browser AA seq 129 aa AA seqDB search MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK TESHKAKGK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgcggcaagcaaggaggcaaagccagagccaaggcaaagacccgatcttcc agagccgggctccagttccccgtgggccgcgtccaccgtctcctccggaagggcaactac gccgagcgggtcggggccggggcgcctgtctacctggcggcggtgctggagtacctgacg gctgagatcctggagttggcgggaaacgcagcccgggacaacaagaagacccgcatcatc ccgcgccacttgcagctggccatccgcaacgacgaggagctgaacaagctgctgggcaga gtcaccatcgcccagggaggcgtcctgcccaacatccaggccgtgctcctccccaagaag accgagagccacaaggccaaggggaagtaa

DBGET integrated database retrieval system