Anolis carolinensis (green anole): 100560544 Help Entry 100560544         CDS       T01608                                  Symbol b2m Name (RefSeq) beta-2-microglobulin   KO K08055   beta-2-microglobulin Organism acs  Anolis carolinensis (green anole) Pathway acs05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:acs00001]  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     100560544 (b2m)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acs04147]     100560544 (b2m) Exosome [BR:acs04147]  Exosomal proteins   Exosomal proteins of breast milk    100560544 (b2m) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  C1-set Ig_3 Motif Other DBs NCBI-GeneID:  100560544 NCBI-ProteinID:  XP_003227530 LinkDB All DBs Position Un Genome browser AA seq 120 aa AA seqDB search MARDLSLLFFAFAFCISSLEATQKAPSVQVYFRHPAEKGKENTFHCYAESFHPPKINITL LKNGIPMENVQQSDLSFKKDWTFERLVYAKVIPDGKAEFACKVEHITLPQPMIYKLDQEY NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggccagagacctcagcctgctctttttcgccttcgctttctgcatctcttccctggaa gccacccaaaaggctcccagcgtacaagtctacttccgccatcctgcggagaaagggaag gagaacacttttcattgttatgcagagagcttccatcctcccaaaatcaatattactctt ctgaagaacggcatcccgatggagaacgtgcagcagtccgacctttcctttaagaaggac tggacctttgagcgcctggtctatgctaaagtcattcctgatgggaaggcggagtttgcc tgcaaagtggagcacatcaccctgccccagccaatgatttacaaattggatcaagagtac taa

DBGET integrated database retrieval system