Anolis carolinensis (green anole): 100563195 Help Entry 100563195         CDS       T01608                                  Symbol rps27a Name (RefSeq) ribosomal protein S27a   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism acs  Anolis carolinensis (green anole) Pathway acs03010   Ribosome acs04120   Ubiquitin mediated proteolysis acs04137   Mitophagy - animal acs04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:acs00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     100563195 (rps27a)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     100563195 (rps27a)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100563195 (rps27a)    04137 Mitophagy - animal     100563195 (rps27a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:acs03011]     100563195 (rps27a)    04121 Ubiquitin system [BR:acs04121]     100563195 (rps27a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acs04147]     100563195 (rps27a) Ribosome [BR:acs03011]  Ribosomal proteins   Eukaryotes    Small subunit     100563195 (rps27a)   Archaea     100563195 (rps27a) Ubiquitin system [BR:acs04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    100563195 (rps27a) Exosome [BR:acs04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100563195 (rps27a)   Exosomal proteins of colorectal cancer cells    100563195 (rps27a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 Rad60-SLD_2 DUF2604 Dsc3_N IBR TBK1_ULD OTU1_UBXL Ubiquitin_5 Motif Other DBs NCBI-GeneID:  100563195 NCBI-ProteinID:  XP_003216177 Ensembl:  ENSACAG00000003302 UniProt:  G1KBR8 LinkDB All DBs Position 1:255741029..255748522 Genome browser AA seq 156 aa AA seqDB search MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVTLAVLKYYKVDENGKISRLRRE CPSEECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgtgaagaccctgacggggaaaaccatcaccctagaggttgaaccatcc gatactatagaaaatgtcaaagccaagatccaggataaggaaggaattcctcctgaccaa cagcgtttgatatttgctggcaaacagttggaagatggacgcactctgtctgattataac attcagaaggagtctaccctccaccttgtgctgagacttcgtggtggagcaaagaagagg aagaagaagtcctacaccacccctaagaagaacaagcacaagaggaagaaggtgacgcta gctgtccttaaatactacaaggtggatgaaaatgggaaaatcagccgcctgcggcgagag tgcccttcagaggaatgtggggcaggagtgttcatggccagccactttgacaggcattac tgtggcaagtgctgcctgacatactgcttcaacaaaccagaggacaaataa

DBGET integrated database retrieval system