Anolis carolinensis (green anole): 100564227 Help Entry 100564227         CDS       T01608                                  Symbol s100a10 Name (RefSeq) S100 calcium binding protein A10   KO K17274   protein S100-A10 Organism acs  Anolis carolinensis (green anole) Pathway acs04382   Cornified envelope formation acs05132   Salmonella infection Brite KEGG Orthology (KO) [BR:acs00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     100564227 (s100a10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100564227 (s100a10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acs04147]     100564227 (s100a10) Exosome [BR:acs04147]  Exosomal proteins   Exosomal proteins of microglial cells    100564227 (s100a10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EFhand_Ca_insen EF-hand_7 EF-hand_6 DUF6837 MOV-10_beta-barrel Motif Other DBs NCBI-GeneID:  100564227 NCBI-ProteinID:  XP_003229717 Ensembl:  ENSACAG00000000615 UniProt:  H9G3V8 LinkDB All DBs Position Un Genome browser AA seq 98 aa AA seqDB search MPSQLEHAMETVMLTFHKFAGDKNYLTKDDLRQLMEKEVPGYMENRKDPMAIDRIMKNLE ECRDGKITFEGYLSLFAGLTNGCNEYYVKKMKPTGKKY NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgccgtcccagctagagcacgccatggaaaccgtcatgctgacgtttcacaaatttgca ggagacaaaaactatctaaccaaagatgacttgcggcagctgatggagaaggaggtccca gggtatatggagaaccggaaagaccccatggccatcgaccggatcatgaagaacttggaa gagtgtcgggacgggaaaatcaccttcgagggatacctctccctgttcgccgggctcacc aacggctgcaacgagtattacgtgaagaagatgaagcccacggggaagaagtattga

DBGET integrated database retrieval system