Anolis carolinensis (green anole): 100566989 Help Entry 100566989         CDS       T01608                                  Symbol rhoa Name (RefSeq) ras homolog family member A   KO K04513   Ras homolog gene family, member A Organism acs  Anolis carolinensis (green anole) Pathway acs04081   Hormone signaling acs04144   Endocytosis acs04150   mTOR signaling pathway acs04270   Vascular smooth muscle contraction acs04310   Wnt signaling pathway acs04350   TGF-beta signaling pathway acs04510   Focal adhesion acs04520   Adherens junction acs04530   Tight junction acs04621   NOD-like receptor signaling pathway acs04625   C-type lectin receptor signaling pathway acs04810   Regulation of actin cytoskeleton acs05100   Bacterial invasion of epithelial cells acs05132   Salmonella infection Brite KEGG Orthology (KO) [BR:acs00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     100566989 (rhoa)    04350 TGF-beta signaling pathway     100566989 (rhoa)    04150 mTOR signaling pathway     100566989 (rhoa)   09133 Signaling molecules and interaction    04081 Hormone signaling     100566989 (rhoa)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100566989 (rhoa)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     100566989 (rhoa)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:acs04131]     100566989 (rhoa)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acs04147]     100566989 (rhoa)    04031 GTP-binding proteins [BR:acs04031]     100566989 (rhoa) Membrane trafficking [BR:acs04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     100566989 (rhoa) Exosome [BR:acs04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100566989 (rhoa)   Exosomal proteins of other body fluids (saliva and urine)    100566989 (rhoa)   Exosomal proteins of colorectal cancer cells    100566989 (rhoa)   Exosomal proteins of bladder cancer cells    100566989 (rhoa) GTP-binding proteins [BR:acs04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     100566989 (rhoa) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU REV SRPRB Gtr1_RagA Motif Other DBs NCBI-GeneID:  100566989 NCBI-ProteinID:  XP_003217600 Ensembl:  ENSACAG00000008297 UniProt:  G1KHL8 LinkDB All DBs Position 2:complement(147509378..147551814) Genome browser AA seq 235 aa AA seqDB search MRAWTRLAFDPPRCFPFSAIAGVWAQRRRKRRRRRKQRSPAVMAAIRKKLVIVGDGACGK TCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTD VILMCFSTDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEP VKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLLL NT seq 708 nt NT seq  +upstreamnt  +downstreamnt atgagagcgtggacgcgccttgctttcgacccgccccgttgctttccgttctcggccatt gccggagtttgggcccagaggaggaggaagaggcggaggagaaggaagcagcggagccct gcagttatggcagccattcggaaaaagctggttatagtcggtgatggtgcctgtggcaag acctgtctgctcattgtatttagtaaagaccagttccctgaagtttacgttccaacagta tttgaaaactatgtagcagatattgaagttgatggaaagcaggtggagctggctttatgg gatacagcaggacaagaagattatgatcgacttaggcctctttcttaccctgacactgat gttatacttatgtgtttttcaacagatagtcctgatagtttagaaaacattccagagaaa tggactccagaagtgaaacacttctgccccaatgtacccatcatcttggtaggaaataag aaggatttgaggaatgatgaacacacaaggcgagagctggccaaaatgaagcaggaacca gtcaaacctgaagagggcagggatatggctaaccgcattggtgcttttggatacatggag tgcagtgcaaagaccaaagacggtgtgagggaagtttttgaaatggccactagagccgct ttacaagctcgacgtggcaagaaaaaatctgggtgccttctcttgtaa

DBGET integrated database retrieval system