Anolis carolinensis (green anole): 100567905 Help Entry 100567905         CDS       T01608                                  Symbol polr2d Name (RefSeq) RNA polymerase II subunit D   KO K03012   DNA-directed RNA polymerase II subunit RPB4 Organism acs  Anolis carolinensis (green anole) Pathway acs03020   RNA polymerase acs03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:acs00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     100567905 (polr2d)   09124 Replication and repair    03420 Nucleotide excision repair     100567905 (polr2d)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:acs03021]     100567905 (polr2d)    03400 DNA repair and recombination proteins [BR:acs03400]     100567905 (polr2d) Transcription machinery [BR:acs03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol II specific subunits      100567905 (polr2d) DNA repair and recombination proteins [BR:acs03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       100567905 (polr2d) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb4 Maelstrom Tfb4 Motif Other DBs NCBI-GeneID:  100567905 NCBI-ProteinID:  XP_003218437 Ensembl:  ENSACAG00000005255 UniProt:  G1KDT8 LinkDB All DBs Position 3:complement(36328658..36335763) Genome browser AA seq 142 aa AA seqDB search MAAGGVDVRAVDVEEDASQLVFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEV FMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEEAKALIPSLEG RFEDEELQQILDDIQTKRSFQY NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atggcggccggaggggtggacgtgagggctgtagatgtggaggaagatgcctcccagctg gtcttccccaaagagtttgagactgctgaaacccttctcaattcagaagtgcacatgctt cttgaacatcggaagcagcagaatgagagtgcagaagatgagcaggagctctctgaagtc ttcatgaaaacgctgaactataccgctcgcttcagccgcttcaaaaaccgggagactatt gctagtgttcgcagtttgctgctccaaaaaaagctccataaatttgaactggcatgttta gctaatctctgtcctgaaacagctgaagaggcaaaagcattaattcccagcttagagggt cgatttgaggatgaagagttacagcaaattcttgatgacattcagaccaaacgaagtttt cagtattag

DBGET integrated database retrieval system