Anolis carolinensis (green anole): 103278509 Help Entry 103278509         CDS       T01608                                  Name (RefSeq) metallothionein-1-like   KO K14739   metallothionein 1/2 Organism acs  Anolis carolinensis (green anole) Brite KEGG Orthology (KO) [BR:acs00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:acs03019]     103278509    03029 Mitochondrial biogenesis [BR:acs03029]     103278509 Messenger RNA biogenesis [BR:acs03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      103278509 Mitochondrial biogenesis [BR:acs03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     103278509 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  103278509 NCBI-ProteinID:  XP_008106734 LinkDB All DBs Position 1:complement(7751262..7763004) Genome browser AA seq 71 aa AA seqDB search MSRANKRMDAQDGPCVSGGVCTCSSNFQCKHCKCKSYIKSCCSWPCLMGCSKCAQGCICK GPPLAKCSFCK NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgtccagagccaacaaaaggatggatgctcaagatggtccctgtgtcagcggtggtgtt tgtacctgcagcagcaactttcagtgcaaacactgcaagtgcaagtcatacataaaaagc tgctgttcctggccctgtctgatgggatgctccaaatgtgctcagggctgcatctgcaaa gggccccctttagccaaatgcagcttctgcaagtga

DBGET integrated database retrieval system