Anolis carolinensis (green anole): 103278638 Help Entry 103278638         CDS       T01608                                  Name (RefSeq) thioredoxin-like   KO K03671   thioredoxin Organism acs  Anolis carolinensis (green anole) Pathway acs04621   NOD-like receptor signaling pathway acs05132   Salmonella infection Brite KEGG Orthology (KO) [BR:acs00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103278638  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103278638  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:acs03110]     103278638 Chaperones and folding catalysts [BR:acs03110]  Protein folding catalysts   Protein disulfide isomerase    103278638 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin DIM1 Thioredoxin_8 AhpC-TSA Glutaredoxin OST3_OST6 Thioredoxin_2 Motif Other DBs NCBI-GeneID:  103278638 NCBI-ProteinID:  XP_008107345 LinkDB All DBs Position 4:86644124..86663639 Genome browser AA seq 105 aa AA seqDB search MVKVIGNLVKFQSELDSTAGKLIVIDFSITWCGPCKMIKPFFYSLVEKYKYVIFIEIDVD DVQDVAAHSEVKSMXTFQFYKNKEKVHEFSRADNERLEETIKKLK NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaaggtcatcggaaacctggtgaaattccaatcagaactagatagtactgcaggg aaactcatagtcattgacttctctatcacatggtgtggaccatgcaaaatgatcaagccc ttcttctatagtcttgttgagaaatataaatatgtcatattcattgaaattgatgtggat gatgttcaggatgttgctgcacatagtgaagtgaagtccatgncaacattccagttctac aaaaacaaggaaaaagtgcatgaattttccagagcagacaacgaaaggctggaagaaacc attaagaagctaaaataa

DBGET integrated database retrieval system