KEGG   Aspergillus clavatus: ACLA_017880
Entry
ACLA_017880       CDS       T01148                                 

Definition
(RefSeq) FAD binding domain protein
  KO
K23668  fumiquinazoline A oxidase [EC:1.5.3.-]
Organism
act  Aspergillus clavatus
Pathway
act00998  Biosynthesis of various secondary metabolites - part 2
act01100  Metabolic pathways
act01110  Biosynthesis of secondary metabolites
Module
act_M00901  Fumiquinazoline biosynthesis, tryptophan + alanine + anthranilate => fumiquinazoline
Brite
KEGG Orthology (KO) [BR:act00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    ACLA_017880
Enzymes [BR:act01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.-  
     ACLA_017880
SSDB
Motif
Pfam: FAD_binding_4 BBE
Other DBs
NCBI-GeneID: 4701354
NCBI-ProteinID: XP_001268511
UniProt: A1CN64
LinkDB
AA seq 490 aa
MISYIVPLLATLPGLVASAATLAPRDDGPADFKAIFDPVLSPGARLYLPGDPEYFNMTSR
WSNLFDPSYIAAIQPANEKDVQNIIKAANKHDIPFLATGSAHSVKPGYTTVKNAINIDLS
LLKNACLDYEKDTITIGPGVLNGEVYDMVYNVKKELPLSTDRCISALGTMIGGGLGTLYS
VRGILADSLVSAHVVTAEGELVTASATENPDLFWAIRGAGHNFGVITSATLKMYDLTNGG
NSVFGDFVIPNARNASAFELLKSVDEDLPAGVFWGILGDFNHTTKQPGLHVRLLVFGDDA
VAAPHLDKIMALDPEVTFWKNTTWNTYGEETPIMCNRRWNSNMYSMGLKHTDVDTMVAAF
TNWSTFAAEHDWFNGLLMIERHSEATVMAVPEKERGVFPWRDTKIQMVFVNYMDDPKYAA
PLDDFIQPTRAEIQSVMGFENHHSYVNEAYGDEGPAVWYGEWNLPRLVELKRKWDPKRQF
GAGMPIPLSL
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgatatcctatattgtccctctgttggcgacattgcccggtttggtggcatcagcggcc
accctcgccccccgcgatgatggcccagcagatttcaaagcgatctttgatcccgtattg
tctcctggggctcggttgtaccttccaggtgacccggaatacttcaacatgacctcgcgg
tggtccaacctgttcgacccgtcctacatcgccgccattcagcctgccaacgagaaggat
gttcagaatatcatcaaagctgctaacaagcacgacatcccgttcttggcgactgggtcg
gctcacagtgtcaagccaggctataccacggtcaagaacgcgattaacatcgatctcagc
ttgttgaaaaatgcgtgtctggactatgaaaaggacacgatcaccatcggccctggtgtt
ttgaatggcgaggtctacgacatggtttacaatgtgaagaaggagctcccgctcagcacg
gatcgctgcatcagcgcccttggcaccatgatcggtggtggtctgggaaccctgtatagt
gttcgcggtattctggccgactctctcgtctcagcccacgtggtgactgctgagggagag
ttggtcaccgcgtccgccaccgagaaccccgatctcttctgggcaatccgtggggcgggg
cacaacttcggcgtcattacctctgctaccctcaagatgtatgacctgaccaacggcggg
aatagcgtgtttggcgatttcgtcatcccgaacgcccggaacgcgtcggcctttgagttg
ttgaagtccgtggacgaagatctgccggcaggtgtcttctggggcattctcggtgatttc
aaccacactacgaaacagcccggactccatgttcgcctcctggtcttcggtgatgacgcc
gttgctgcgccccatctggacaagatcatggctctggaccccgaggtcaccttctggaag
aacaccacctggaacacgtacggtgaagagacgcccatcatgtgcaaccgccgctggaac
tccaacatgtactccatgggtctcaagcataccgacgtggacaccatggtcgcagcgttt
accaactggagcacgttcgcggccgagcatgactggttcaatggcttgctgatgatcgaa
agacactccgaggccactgtcatggccgtcccggagaaggagagaggtgtcttcccttgg
agagacaccaagattcagatggtctttgtcaactacatggacgatcccaaatatgccgcc
ccgctggacgacttcatccagccaactcgagcagagatccagtccgtcatggggttcgag
aaccatcacagctacgtgaatgaggcatacggcgacgaaggccccgccgtatggtacggc
gagtggaatttacctcgactggtggaattgaagcggaaatgggacccgaaacgtcaattt
ggagccggcatgcctattccgttgagtctttga

DBGET integrated database retrieval system