Actinoalloteichus sp. AHMU CJ021: C1701_02390 Help Entry C1701_02390       CDS       T05306                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism acta  Actinoalloteichus sp. AHMU CJ021 Pathway acta01056   Biosynthesis of type II polyketide backbone acta01100   Metabolic pathways acta01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acta00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     C1701_02390    00253 Tetracycline biosynthesis     C1701_02390  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:acta01004]     C1701_02390    01008 Polyketide biosynthesis proteins [BR:acta01008]     C1701_02390 Lipid biosynthesis proteins [BR:acta01004]  Polyketide synthase   Component type    C1701_02390 Polyketide biosynthesis proteins [BR:acta01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      C1701_02390     Nonaketide PKS      C1701_02390     Decaketide PKS      C1701_02390 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AUS77408 LinkDB All DBs Position complement(669356..669619) Genome browser AA seq 87 aa AA seqDB search MSRFDLDELRQIMRSSAGVDEGVDLAGDIGDLEFGDLGYDSLAVLELVSHVQRAHGIVIP DEAVEEMPTPNRAVEYINRLAMEGNRS NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagcaggttcgacctcgacgaactccgccagatcatgcggtccagcgcgggggtggac gagggagtcgacctcgccggcgacatcggcgacctggagttcggcgacctgggctacgac tcgctcgccgtcctggaactggtcagccacgtccagcgcgcccacgggatcgtcatcccc gacgaggcggtggaggagatgccgaccccgaaccgggcagtggagtacatcaaccggctg gcgatggaagggaaccgttcctga

DBGET integrated database retrieval system