KEGG   Actimicrobium sp. CCC2.4: RHM62_07070
Entry
RHM62_07070       CDS       T09612                                 
Symbol
truB
Name
(GenBank) tRNA pseudouridine(55) synthase TruB
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
actb  Actimicrobium sp. CCC2.4
Brite
KEGG Orthology (KO) [BR:actb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:actb03016]
    RHM62_07070 (truB)
Enzymes [BR:actb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     RHM62_07070 (truB)
Transfer RNA biogenesis [BR:actb03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    RHM62_07070 (truB)
 Prokaryotic type
    RHM62_07070 (truB)
SSDB
Motif
Pfam: TruB_N TruB_C_2 TruB-C_2
Other DBs
NCBI-ProteinID: WPX33580
LinkDB
Position
1511531..1512463
AA seq 310 aa
MATFPPRKKRVPVHGVLLLDKAAGHSSNDALIKAKRLFNAEKAGHTGTLDPFATGLLPLC
FGEATKFAQDLLEADKTYETVVHLGLRSDTGDTEGQILETLPVDVTRAQIDAVLEKFRGP
IDQVPPMYSALKRDGKPLYEYARAGITLEREARPVVIHLLEFVRYEAPFLTLRVSCSKGT
YIRVLGEDIGAALGCGAHLNALRRTRVGDLVLADAVTLEQIMAFAEDQRGTMLAPVDALL
ASFPLLSLTDELARRFLHGQRLSLGKEAIALPATEGRVRVFRESDACLLGTGLMQEFGVL
APERLVSTAT
NT seq 933 nt   +upstreamnt  +downstreamnt
atggcaacttttccaccccgtaaaaaacgcgttccggtgcatggcgtgctgctgctcgac
aaggcagcagggcactcgagcaacgatgcgctgatcaaggccaagcgcttgttcaatgcc
gagaaggccggtcacaccggtacgctagacccgttcgcgaccggcttgctgccgctgtgt
ttcggcgaagcgaccaagttcgcacaggacttgctcgaggccgacaagacctacgaaacc
gtggtgcatcttggcttgcgcagtgataccggcgacaccgaaggccagattctcgagacc
ttgccggtggatgtgacgcgggcgcagatcgacgccgtgctcgaaaaattccgtggtcct
atcgatcaggtgccaccgatgtattcggccctgaaacgtgacggcaaaccgttgtacgaa
tatgcacgcgccggcatcacgctggaacgcgaagcgcgtccggtagtgattcatttgctg
gagttcgtccgttacgaagcgccttttctgaccttgcgtgtgagctgcagcaaaggcact
tacatccgcgtactcggcgaagacatcggtgcggcgctcggttgcggcgctcatctgaac
gcgttgcgccggacccgggtgggcgatctggtattggccgatgcagtcacgctcgaacag
atcatggccttcgcggaagaccagcgcggcaccatgctcgcgccggtcgatgccttgctg
gcgagttttccgctgctgtcactgaccgatgaactggcgcgccgcttcctgcacggacag
cgcctgtcgctgggcaaggaagccattgcgctgccagcgaccgaaggcagggtgagagtg
ttccgggagtccgatgcgtgcttgctgggtactggcctgatgcaggaattcggcgtactg
gcaccggagcgtctggtttctacagcaacgtga

DBGET integrated database retrieval system