Actimicrobium sp. CCC2.4: RHM62_16375 Help Entry RHM62_16375       CDS       T09612                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism actb  Actimicrobium sp. CCC2.4 Brite KEGG Orthology (KO) [BR:actb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:actb03036]     RHM62_16375    03400 DNA repair and recombination proteins [BR:actb03400]     RHM62_16375 Chromosome and associated proteins [BR:actb03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     RHM62_16375 DNA repair and recombination proteins [BR:actb03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       RHM62_16375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N FERM_f0 DUF1811 FMN_bind Motif Other DBs NCBI-ProteinID:  WPX31793 LinkDB All DBs Position complement(3558404..3558694) Genome browser AA seq 96 aa AA seqDB search MSTYKELTVQIENLQKQAAHARQSEIANAIADIKEKMRDYGITLTDLGLTGAKKVGKAKE PVAAKYRDTVSGATWSGRGKPPRWIAGQDRDAFIIK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgtcaacatacaaagaattaactgttcagattgaaaatcttcaaaagcaagctgctcat gcccgtcagagtgaaatcgctaatgcgatcgccgatatcaaagaaaaaatgcgcgactat gggattaccttgacagatcttggtttgacgggcgcaaagaaagtcggtaaggcgaaggag cctgtcgctgcaaagtaccgtgatacggtttccggtgcgacatggtccggtcgtggcaag ccaccacgctggattgcagggcaggatcgggatgcgttcattatcaagtaa

DBGET integrated database retrieval system