Actinoplanes sp. OR16: ACTI_14240 Help Entry ACTI_14240        CDS       T10317                                  Name (GenBank) hypothetical protein   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism acte  Actinoplanes sp. OR16 Pathway acte03430   Mismatch repair Brite KEGG Orthology (KO) [BR:acte00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     ACTI_14240  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:acte03400]     ACTI_14240 Enzymes [BR:acte01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      ACTI_14240 DNA repair and recombination proteins [BR:acte03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      ACTI_14240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S Spectrin_SYNE1 PipA CHASE3 HU-CCDC81_bac_2 T2SSF Motif Other DBs NCBI-ProteinID:  BBH64739 UniProt:  A0A3T1APA5 LinkDB All DBs Position 1558673..1558876 Genome browser AA seq 67 aa AA seqDB search MTDENLSYEQARTELASVVERLEQGGGTLEESLALWERGEKLADVCQRWLDGARGRIEAA RAARPGD NT seq 204 nt NT seq  +upstreamnt  +downstreamnt gtgaccgacgagaacctcagctacgagcaggcccgcaccgagctggcatcagtggtggag cggctggagcagggcggcggcaccctggaggagtcgctcgccctgtgggagcgcggcgag aagctggccgacgtctgccagcgctggctcgacggcgcccgggggcgcatcgaggcggcc cgggccgcccggccgggggattag

DBGET integrated database retrieval system