Actinomyces sp. HMT897: JJJ15_11040 Help Entry JJJ15_11040       CDS       T10470                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism acth  Actinomyces sp. HMT897 Brite KEGG Orthology (KO) [BR:acth00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:acth03032]     JJJ15_11040    03036 Chromosome and associated proteins [BR:acth03036]     JJJ15_11040    03400 DNA repair and recombination proteins [BR:acth03400]     JJJ15_11040 DNA replication proteins [BR:acth03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     JJJ15_11040 Chromosome and associated proteins [BR:acth03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     JJJ15_11040 DNA repair and recombination proteins [BR:acth03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       JJJ15_11040 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF7342 HU-DNA_bdg DSBA DUF2267 Motif Other DBs NCBI-ProteinID:  QQO77540 UniProt:  A0A974N9H5 LinkDB All DBs Position 2853372..2853653 Genome browser AA seq 93 aa AA seqDB search MSVNRTELIAAIAEKAGLTKTDADTFLGAFQDVLVENVAKGEAVKITGLMGVERVERAAR TGRNPRTGEEIQIPAGYGVKLTAGSALKKAVQA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgtccgtcaaccgcactgagctcattgccgccatcgctgagaaggctggtctgaccaag accgacgccgacaccttcctcggcgccttccaggacgtcctggtggagaacgtcgccaag ggtgaggccgtcaagatcaccggtctcatgggggtcgagcgcgtcgagcgcgccgcccgc accggtcgcaacccgcgcacgggcgaggagatccagatcccggccggctacggcgtcaag ctcactgccggctccgccctcaagaaggccgtccaggcctga

DBGET integrated database retrieval system