Actinoalloteichus sp. GBA129-24: UA75_11100 Help Entry UA75_11100        CDS       T04619                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism acti  Actinoalloteichus sp. GBA129-24 Pathway acti01056   Biosynthesis of type II polyketide backbone acti01100   Metabolic pathways acti01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acti00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     UA75_11100    00253 Tetracycline biosynthesis     UA75_11100  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:acti01004]     UA75_11100    01008 Polyketide biosynthesis proteins [BR:acti01008]     UA75_11100 Lipid biosynthesis proteins [BR:acti01004]  Polyketide synthase   Component type    UA75_11100 Polyketide biosynthesis proteins [BR:acti01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      UA75_11100     Nonaketide PKS      UA75_11100     Decaketide PKS      UA75_11100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  APU20232 UniProt:  A0A1L7F5Z8 LinkDB All DBs Position 2468266..2468526 Genome browser AA seq 86 aa AA seqDB search MSRFTLEELREIMRTSAGVDEGVDLDSDIGDLEFDELGYDSLAVLEFASIVQRRYGVPIP DDIVTESGTPSKAVHFINTQIEKAGV NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcaggttcaccctggaggaactgcgggagatcatgcgcaccagcgcaggcgtcgac gagggcgtcgacctggactccgacatcggagacctcgagttcgacgagctgggctacgac tcgctggccgtcctggagttcgccagcatcgtgcagcgccgctacggcgtgccgatcccg gacgacatcgttaccgagtctggaacgccttcgaaggcggtccacttcatcaacacgcag atcgagaaggcaggggtctga

DBGET integrated database retrieval system