KEGG   Actinoalloteichus sp. GBA129-24: UA75_14070
Entry
UA75_14070        CDS       T04619                                 
Name
(GenBank) hypothetical protein
  KO
K01297  muramoyltetrapeptide carboxypeptidase [EC:3.4.17.13]
Organism
acti  Actinoalloteichus sp. GBA129-24
Brite
KEGG Orthology (KO) [BR:acti00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:acti01002]
    UA75_14070
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:acti01011]
    UA75_14070
Enzymes [BR:acti01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.13  muramoyltetrapeptide carboxypeptidase
     UA75_14070
Peptidases and inhibitors [BR:acti01002]
 Serine peptidases
  Family S66
   UA75_14070
Peptidoglycan biosynthesis and degradation proteins [BR:acti01011]
 Precursor biosynthesis
  Carboxypeptidase
   UA75_14070
SSDB
Motif
Pfam: Peptidase_S66 Peptidase_S66C
Other DBs
NCBI-ProteinID: APU20824
LinkDB
Position
complement(3182217..3183143)
AA seq 308 aa
MTGARRPRRLVPGDRVAIVAPAGPVTAPVLAAGVAILESWGLDVVVGAHVLDRHPDFPYL
AGRDEDRAEDLTKAWLDPDIAGVLCARGGYGCTRTLQRLDLAAFAGAPPKVFAGSSDVTA
LHQAFGSRLDLVTLFSPMVGSAPFVDHPGAVETLRRTLLEPESALVLGRPGAGPLVSGRA
RGLSWGGNLSLLAADIGTTDAYPPPPGAVVLLEDVGEDLYRLDRMLTQLDRAGWWQDVAG
FALGSWTDCGPLADVRTLVLDRLGGLGVPVGWELGFGHCDDQLTVPLGVPVELDADAGTL
RLDEAALT
NT seq 927 nt   +upstreamnt  +downstreamnt
atgacgggcgcccgacgccctcgcaggctggtccccggcgatcgggtggcgatcgtcgcc
cccgcaggaccggtgacggccccggtgctggctgccggggtggcgatcctggagagctgg
gggctcgacgtcgtggtgggcgcccacgtcctggaccggcatccggacttcccctacctg
gcgggccgggacgaggatcgcgccgaggacctcacgaaggcctggctcgacccggacatc
gcgggcgtgctctgtgccaggggcggctacggctgcaccagaaccctgcaacggctcgac
ctcgcggcgttcgccggggcaccgccgaaggtgttcgccgggtccagcgacgtgacggcc
ctgcatcaggccttcggcagcaggctggacctcgtgacgctgttctcgccgatggtgggc
agcgcgccgttcgtcgatcaccccggcgccgtggagacgctgcgtcgaaccctgctggaa
ccggagtccgccctcgtgctgggcaggccgggagcgggaccgctggtgtccggccgggca
cgaggactcagctggggcggaaacctcagtctgctggccgccgacatcggcaccaccgac
gcctatccgccgccgccgggggcggtcgtgctgctggaggacgtcggcgaggacctctac
cgactggatcggatgctcacccagctggaccgggcgggctggtggcaggacgtcgcgggc
ttcgcgctcggctcctggaccgactgcggaccgctggcggacgtccggacgctggtgctc
gatcggctgggcgggctgggcgtgcccgtcggctgggagctgggcttcggccactgtgat
gatcagctcaccgtgcccctgggcgtgccggtggagctggatgccgatgcgggcacgctg
agactcgacgaagccgctttgacctga

DBGET integrated database retrieval system