Actinoalloteichus sp. GBA129-24: UA75_16780 Help Entry UA75_16780        CDS       T04619                                  Name (GenBank) hypothetical protein   KO K16025   methoxymalonate biosynthesis acyl carrier protein Organism acti  Actinoalloteichus sp. GBA129-24 Pathway acti01051   Biosynthesis of ansamycins acti01052   Type I polyketide structures Brite KEGG Orthology (KO) [BR:acti00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01052 Type I polyketide structures     UA75_16780    01051 Biosynthesis of ansamycins     UA75_16780  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:acti01008]     UA75_16780 Polyketide biosynthesis proteins [BR:acti01008]  Polyketide tailoring proteins   Others    UA75_16780 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  APU21364 LinkDB All DBs Position complement(3753038..3753313) Genome browser AA seq 91 aa AA seqDB search MTDSTIASSVAGIERRIGEFLEAKTRRTWEPEVDLFASGVVSSLFAMELVVFVEGTFGVV VEGADLTLDNFRTLRSMSSLVTRLRGGEAGA NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgacggactcgacgattgcgtcatcggtcgctgggatcgagcggcgaatcggtgagttt ctcgaggcgaagaccaggaggacctgggaaccggaggtggacctgttcgcctccggcgtg gtctcctcgctcttcgcgatggagctggtggtgttcgtggagggcacgttcggcgtcgtc gtcgagggcgccgacctcacgctcgacaacttccgcaccctgcggtcgatgagctcgctg gtgacccggctgcgcggcggcgaagctggtgcttga

DBGET integrated database retrieval system