Actinoalloteichus sp. GBA129-24: UA75_17515 Help Entry UA75_17515        CDS       T04619                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism acti  Actinoalloteichus sp. GBA129-24 Pathway acti00998   Biosynthesis of various antibiotics acti01100   Metabolic pathways acti01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acti00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     UA75_17515    00074 Mycolic acid biosynthesis     UA75_17515   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     UA75_17515 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding DUF6214 Motif Other DBs NCBI-ProteinID:  APU21493 LinkDB All DBs Position 3991719..3991979 Genome browser AA seq 86 aa AA seqDB search MDLIETRLRQVIADARQPRIEPADIPSTGLLDTLGLDSGACLSLLLSVEEEFDIEIEDAD LSPRLVDDLTVLADYVRSRTGSLELS NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggacctgatcgagacgaggctgcgccaggtgatcgcggatgcgcggcagccgcgcatc gagccggccgacatccccagtaccggactgttggacacgctcggcctcgactccggtgcc tgtctgagtctcctgctcagcgtggaagaggagttcgacatcgagatcgaggacgcggac ctctccccccgtctggtggacgatctgacggtgttggccgactacgtccggagtcggacc ggctcgctcgagctgagctga

DBGET integrated database retrieval system