Actinomyces sp. oral taxon 897: C3V41_00810 Help Entry C3V41_00810       CDS       T05399                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism acto  Actinomyces sp. oral taxon 897 Brite KEGG Orthology (KO) [BR:acto00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:acto03032]     C3V41_00810    03036 Chromosome and associated proteins [BR:acto03036]     C3V41_00810    03400 DNA repair and recombination proteins [BR:acto03400]     C3V41_00810 DNA replication proteins [BR:acto03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     C3V41_00810 Chromosome and associated proteins [BR:acto03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     C3V41_00810 DNA repair and recombination proteins [BR:acto03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       C3V41_00810 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-DNA_bdg DSBA DUF2267 DUF7342 Motif Other DBs NCBI-ProteinID:  AVM60865 LinkDB All DBs Position 199040..199321 Genome browser AA seq 93 aa AA seqDB search MSVNRTELIAAIAEKAGLTKTDADTFLGAFQDVLVENVAKGEAVKITGLMGVERVERAAR TGRNPRTGEEIQIPAGYGVKLTVGSALKKAVQA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgtccgtcaaccgcactgagctcattgccgccatcgctgagaaggctggtctgaccaag accgacgccgacaccttcctcggcgccttccaggacgtcctggtggagaacgtcgccaag ggtgaggccgtcaagatcaccggtctcatgggggtcgagcgcgtcgagcgcgccgcccgc accggtcgcaacccgcgcacgggcgaggagatccagatcccggccggctacggcgtcaag ctcactgtcggctccgccctcaagaaggccgtccaggcctga

DBGET integrated database retrieval system