Actinomyces gaoshouyii: B6G06_02820 Help Entry B6G06_02820       CDS       T04911                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism actp  Actinomyces gaoshouyii Brite KEGG Orthology (KO) [BR:actp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:actp03032]     B6G06_02820    03036 Chromosome and associated proteins [BR:actp03036]     B6G06_02820    03400 DNA repair and recombination proteins [BR:actp03400]     B6G06_02820 DNA replication proteins [BR:actp03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     B6G06_02820 Chromosome and associated proteins [BR:actp03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     B6G06_02820 DNA repair and recombination proteins [BR:actp03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       B6G06_02820 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-DNA_bdg DUF5321 DUF7342 Motif Other DBs NCBI-ProteinID:  ARD41432 UniProt:  A0A8H9HA03 LinkDB All DBs Position 710259..710543 Genome browser AA seq 94 aa AA seqDB search MSVNRTELIAAIAAKTDLKKTDADAFLAAFQEVLVESVSKGEAVKITGLMGVERVKRAAR TGRNPRTGEEIQIPAGYGVKLTVGSALKKAVADN NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgtccgtcaaccgcaccgagctcatcgcagccatcgccgccaagaccgatctgaagaag accgatgccgatgccttcctcgccgccttccaggaggttctcgttgagagtgtctcgaag ggcgaggctgtcaagatcacgggcctgatgggtgtggagcgcgtcaagcgcgccgcccgc actggccgtaacccccgcaccggcgaggagatccagatccccgcgggctacggcgtgaag ctgacagtgggctcggccctcaagaaggctgtcgccgacaactga

DBGET integrated database retrieval system