Actinoplanes sp. NBRC 14428: Asp14428_27770 Help Entry Asp14428_27770    CDS       T08315                                  Symbol acpP_3 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism actr  Actinoplanes sp. NBRC 14428 Pathway actr00998   Biosynthesis of various antibiotics actr01100   Metabolic pathways actr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:actr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Asp14428_27770 (acpP_3)    00074 Mycolic acid biosynthesis     Asp14428_27770 (acpP_3)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Asp14428_27770 (acpP_3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  BCJ51302 LinkDB All DBs Position 2983839..2984081 Genome browser AA seq 80 aa AA seqDB search MATRAEITSGLAEILEEVAGVNPDDVAEEKSFTDDLDVDSLSMVEVVVAAEEKFGVKIPD NEVQNLKTVGDAVSFIEANH NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggctacccgcgctgagatcacttccggcctcgccgagattctcgaggaggtcgccggg gtgaacccggacgacgtcgccgaggagaagtccttcaccgacgacctggacgtcgactcg ctgtccatggtcgaggtcgtggtggccgccgaggagaagttcggcgtcaagatccccgac aacgaggtccaaaacctcaagaccgtcggcgacgccgtctccttcatcgaggcgaaccac tga

DBGET integrated database retrieval system