Actinoplanes sp. SE50: ACWT_1402 Help Entry ACWT_1402         CDS       T05392                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism acts  Actinoplanes sp. SE50 Pathway acts00998   Biosynthesis of various antibiotics acts01100   Metabolic pathways acts01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acts00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACWT_1402    00074 Mycolic acid biosynthesis     ACWT_1402   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACWT_1402 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ATO80817 LinkDB All DBs Position complement(1590773..1591015) Genome browser AA seq 80 aa AA seqDB search MATREEITSGLAEILEEVAGVNPDDVAEGKSFTDDLDVDSLSMVEVVVAAEEKFGVKIPD NEVQNLKTVGDAVSYIEANA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggctactcgtgaagagatcacctccggcctcgccgagatcctcgaggaggtcgccggg gtgaacccggacgacgtcgccgagggcaagtcgttcaccgatgatctggacgtcgactcg ctgtcgatggtcgaggtcgtggtcgcggccgaggagaagttcggcgtgaagatcccggac aacgaggtgcagaacctgaagaccgtcggcgacgccgtcagctacatcgaggcgaacgcc tga

DBGET integrated database retrieval system